SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013553 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013553
Domain Number 1 Region: 277-462
Classification Level Classification E-value
Superfamily MIR domain 5.1e-35
Family MIR domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013553   Gene: ENSDORG00000014415   Transcript: ENSDORT00000014414
Sequence length 672
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2661:3187:19935:1 gene:ENSDORG00000014415 transcript:ENSDORT00000014414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FDEVYYGVFISLYMKRTFFIDNSGPPFGHMLLALGGYLGGFDGNFLWNRIGEEYTSNVPV
WSLRLLPALAGALSVPMAYQIVSELHFSHCAAMGAALLVLMENALITQARLMLMESLLIF
FNLLAVLSYLKFFNCQRHSPFSLCWWLWLMLTGVACSCAVGIKYMGIFTYFLVLGVAAVH
AWQLIGDQTLTNVGADLHLTGPAREGTGRGGCLSQGVCVCCHLLARAVALLVIPVVLYLL
FFYVHLMLLYRSGPHDQVMSSAFQASLEGGLARITQGQPLEVAFGSQVTLRNVFGKPLPC
WLHSHQSTYPVIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPARHPLVVSSPPRPVRHGD
IVQLVHGMTTRFLNTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDIVNRESDRDVWK
TILSEVRFVHVNTSAILKLSGAHLPDWGFRQLEVVGEKRSRGLHESTVWTVEEHRYGNSQ
EQRERELELHSPTHVDISRNLSFMARFSELQWRMLTLRGEDSEHKYSSTPLEWVTLDSNI
AYWLHPSTTAQIHLLGNVVIWASASLATAAHALLFLWHLLRRRRRACDLPEDAWHRWVLA
GALCTGGWALNYLPFFFMEKTLFLYHYLPALTFQILLLPLVLQHISDHLCRSGLQRSLFS
ALVVAWYSSACH
Download sequence
Identical sequences ENSDORP00000013553 ENSDORP00000013553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]