SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013555 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013555
Domain Number 1 Region: 2-103
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000000222
Family Kelch motif 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013555   Gene: ENSDORG00000014417   Transcript: ENSDORT00000014416
Sequence length 299
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3100:487:6108:1 gene:ENSDORG00000014417 transcript:ENSDORT00000014416 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
THQWDLATWEGLLPRYEHASFIPSCTPDSIWIFGGADQSGNRNCLQVLNPETRAWTTPEV
TNSPPCPRTFHTSTAAIGNKLYVFGGGERGAQPVQDMKLHVFDAXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXKQHWTLLKFDTFLPAGRLDHSMCIIPWSVTSASEK
DLNSVTLNFEDEKGDSTGKRVYKDGDSQANQADTLLCFVFGGMNTEGEIYDDCLVTVVD
Download sequence
Identical sequences ENSDORP00000013555 ENSDORP00000013555

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]