SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013572 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013572
Domain Number 1 Region: 160-263
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.27e-28
Family Ankyrin repeat 0.00061
Further Details:      
 
Domain Number 2 Region: 41-126
Classification Level Classification E-value
Superfamily Acyl-CoA binding protein 3.92e-27
Family Acyl-CoA binding protein 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013572   Gene: ENSDORG00000014433   Transcript: ENSDORT00000014433
Sequence length 282
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2021:107596:211783:-1 gene:ENSDORG00000014433 transcript:ENSDORT00000014433 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPFLPAGAATGDSGGELSSGDDSGDMECLQSPESDPSRSLAELFEKAAAHLQGLVQVA
SREQLLYLYARYKQVKVGNCNTPKPGFFDFEGKQKWEAWKALGDSSPNQAMQEYIAAVKK
LDPGWNPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXEEDKNIFDYCRENNIDHITKAIKS
KNVEVNMRDEEGRALLHWACDRGHKELVTVLLQYKADINCQDNEGQTALHYAAACEFLDI
VELLLQSGADPTLRDQDGCLPQEVTGCKAVSLVLQRHTTSKA
Download sequence
Identical sequences ENSDORP00000013572 ENSDORP00000013572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]