SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013593 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013593
Domain Number 1 Region: 2007-2174
Classification Level Classification E-value
Superfamily C-type lectin-like 1.28e-31
Family C-type lectin domain 0.00085
Further Details:      
 
Domain Number 2 Region: 1737-1850
Classification Level Classification E-value
Superfamily CalX-like 4.97e-22
Family CalX-beta domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013593   Gene: ENSDORG00000014455   Transcript: ENSDORT00000014455
Sequence length 2175
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5589:101108:226545:-1 gene:ENSDORG00000014455 transcript:ENSDORT00000014455 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAPRWARPEALLLLLLLDWTSSTFITVNRGMRVMKGSSAVLSAEDLKFAIPREKDACKV
EVVRNEPITQRVGKLTPQVFDCHFLPNEVRYVHNGCPILDEDTVKLRLYRFTETDTFMET
FELQVHLLEPDCNIIHMNDKVLEVSEFYGLSRTIDKNLLSFDYDRTANLECTIRLDPLTT
LLPAHGQMVVVEPLPEGPRGDQPHSFFPESQLGTELKCPGGSCALGLKKIGSLKVSCEEF
LLMGLRYQHMQPPSPNIDYIPIQLDLMDSRSKIVYKKSERAWLPVFIRAGIPNQIPRAAF
MAMFILEVDQFILTSLTTLVLDCEEDETPKPLLVFNITKAPLQGYVTHLSDHTRPISSFT
WRDLSDLQIAYQPPNSSHSERRHYEIELEVLDFFFGKSAPIVVHISIRTADTNAPRVSWN
TXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKGFLFTVADLQAG
VVRYHHDDSDSTKDFVVFRIFDGFHSTRHKFPINILPKDDSPPFLITNVVIELEEGQTIL
IQGSMLRASDMDSSDDYIFYNITKPPQAGEIMKKPGPGLTGYPVQGFLQRDLFNGIISYR
HFGGEIFEDSFEFVLWDSHEPPNLSGPQVVTIHIIPVDDQLPKEAPGVSRHLVVKETEVA
YITKKHLHFLDMESCDRELLYTVTTPPFFSFGPRHSDAGKLFMVDSIPKLTKNPVALGLR
SFTHHAVNHMKVAYMPPMQDIGPHLQHVQFTVSISNQHGGTLHGICFNITILPVDNQVPE
VFTNSLRVAEGRQCIVDTEHIHVSDVDTLLDNIYLSLTGTPLSGRVELNGFPLNPGDTFS
WSDLHTLKVRYQHDGSEVLQDDICLEVTDGKNSAEFVLHVEVFPVNDEPPVLKADLIAVM
PCLEGGEVVITPEYLGATDMDSDDLTLVFMIVGEPRHGMVRKAGVSVDRFSQADVISGAV
TYRHTGGEIGLVPCFDTITLVVLDGEASPVINGCCYHRPDPSALHEAFPVYDLNITVHPV
DNQPPSIEIGTMFVVDEGFSAAITINHLSVTDPDTAADDLEFVLVSPPQFGYLENTLPSA
GFEKSNMGISISSFQWRDMKSLHINYVQSKHLRIEPTADQFVVSVTDGSQRSSETSFYIR
INPTNDEAPDFVVQNLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKLSYVHDGSEGLADDFAVQLSDGKHKI
VKMISVEVFPVNDEKPTLSKKAEVVVNVGDTRILSSAVLSAIDKDSPREKIYYLFEKLPQ
NGQLQLKIRRGWVPLSPGMKCTQMDVDLNLLRYTHTGAIDSHDGDSFTFYLWDGDNRSPA
YDCHITIKDMGKGDIVILAKPLVVSKGDRRILTTSTLLAVDATDRPEELVYVITSPPQHG
QVEYVRYPGVPITSFSQMDVAGQTVCYVHMSKAAVCHDSFRFIISNGLQTKHGVFEIILE
TVDKALPVVTRNKGLRLAEGAMSLLSPDQLQVTDPDTSAENLTFILDQLPQHGQLYLRGS
VLIQLNFTQQDVDSRKVAYQHSGGHSHTDCFTFVVTDRTNRGFVVDGRVQEEPVSFTIQD
QLDKTAPRITHLHFPSQVSLLKNGCYGIYITSHVLKASDPDTEDDEIIFKIRGPLHGHEN
TTTGEFIHEKFSQKDLNSKTILYMINPSLEVNSDFMELQVTDPTGNSATPQILELKWSHI
EWSQSEYEVCENVGMLTLEVTRRGYSMDSAFVSIKVNQVSATVGKDFTVTPSKLIQFDPG
MSTKMWNIAITYDGLEEDDEVFEVILNSPVNAVLGTKTKAAVKILDSKGGQCLTSYSSNH
SQHKAWEKGVWPFLPSGSSSSIPGGFPHLERRYPSSSKQLVVTKGSTLRSFDAAVLSQRK
LRTHGNGKAXXXXXXXXXXXXXXXXYHGVVSLRLEDDSFPTHKRKATVSILSQPHRRVKA
AELPLAETESTSASHFPRQNQLPSFPKNCMVEIKGLLHFEESNQKLYQCNGIAWKIWSPQ
TKEVEDKSCPAGWHLHSGYCHTLITGQKSTWALATRACREQHLGNLVTVFSRQHMQWLWH
ISGKKPFWIGLNDQEHAGRWVWIGGEPVVFTNWRRGRPQNSRPGKNCVLVQKQGKWQTKN
CGKGKPHNFICSWKL
Download sequence
Identical sequences ENSDORP00000013593 ENSDORP00000013593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]