SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013646 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013646
Domain Number 1 Region: 28-285
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.08e-124
Family MioX-like 0.000000000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013646   Gene: ENSDORG00000014511   Transcript: ENSDORT00000014511
Sequence length 285
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1084:64915:67057:1 gene:ENSDORG00000014511 transcript:ENSDORT00000014511 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVVMGPDPSLIYRPDTDPEMTKDKDSFRNYMSGPLLDRVFTTYKLMHTHQTVDFVNRKR
AQFGSFSYKKMTVMEAVDLLDDLVDASDPDVDFPNSFHAFQTAEGIRKAHPDKDWFHLVG
LLHDLGKVLALWGEPQWAVVGDTFPVGCRPQASVVFRDCTFQDNPDLQDPRYSTELGMYQ
PHCGLENVLMSWGHDEYLYQMMKFNKFSLPWEAFYMVRFHSFYPWHTGGNYRQLCNQQDL
DMLPWVQEFNKFDLYTKSPDLPDVHQLRPYYQGLIDKYCPGVLSW
Download sequence
Identical sequences A0A1S3FXI2
ENSDORP00000013646 XP_012881266.1.60039 ENSDORP00000013646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]