SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013660 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013660
Domain Number 1 Region: 932-1081
Classification Level Classification E-value
Superfamily C-type lectin-like 1.92e-37
Family C-type lectin domain 0.00045
Further Details:      
 
Domain Number 2 Region: 22-153
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.45e-34
Family Cysteine rich domain 0.000000592
Further Details:      
 
Domain Number 3 Region: 501-638
Classification Level Classification E-value
Superfamily C-type lectin-like 5.57e-32
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 4 Region: 1220-1357
Classification Level Classification E-value
Superfamily C-type lectin-like 4.2e-31
Family C-type lectin domain 0.00023
Further Details:      
 
Domain Number 5 Region: 854-926
Classification Level Classification E-value
Superfamily C-type lectin-like 1.33e-20
Family C-type lectin domain 0.00096
Further Details:      
 
Domain Number 6 Region: 153-211
Classification Level Classification E-value
Superfamily Kringle-like 6.85e-20
Family Fibronectin type II module 0.00071
Further Details:      
 
Domain Number 7 Region: 272-344
Classification Level Classification E-value
Superfamily C-type lectin-like 1.54e-17
Family C-type lectin domain 0.00086
Further Details:      
 
Domain Number 8 Region: 350-416
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000000157
Family C-type lectin domain 0.004
Further Details:      
 
Domain Number 9 Region: 1162-1222
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000262
Family C-type lectin domain 0.0024
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013660
Domain Number - Region: 467-488
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0121
Family C-type lectin domain 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013660   Gene: ENSDORG00000014526   Transcript: ENSDORT00000014527
Sequence length 1454
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5963:31522:111142:1 gene:ENSDORG00000014526 transcript:ENSDORT00000014527 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLYLFLAFVAAMPLAVQLLDTRQFLIYNEDHKRCVEALSPTSVQTAVCNPDSESQKFRW
VSDSQVMSVAFKLCLGVPSKTDWVAVTLYACDSKSQYQKWECKNDTLFGIKGEDLFFNYG
NRQEKNIMLYKGSGLWSRWKIYGTTDDLCSRGYEAMYTLLGNANGATCAFPFKFENKWYA
DCTNVGRSDGWLWCGTTTDYDTDKLFGFCPLKFEGSERLWSXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXLTSSLTSGLWIGLNSLNFNTGWQWSGGSPFRY
LNWLPGSPSSEPGKSCVSLNPEKNAKWESLECVQKLGYICKKGNNTLNSFIIPSESDVPT
SCPSLWWPYSGYCYKIHREEKKIQRDALRACRKEGGDLASIHTIEEFDFILSQLGYXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGLWADRACEK
PLNYICKMKSQTRDPGEVEVERGCRKGWKRHGFYCYLIGRTLSTFTEANQTCHSEKAYLT
TVEDRYEQAFLTSLVGLRPEKYFWTGLSDVQNKGTFQWTVEEEVHFTHWNSDMPGRKAGC
VAMRTGIAGGLWDVLKCDEKAKYVCKHWAEGVTRPPEPTTTPEPKCPEDWGTSSKTSLCF
KXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXVNKNGMQTPYFIGLLISLDKKFTWMDGSKVDYVAWATGEPNFANEDENCV
TMYTNSGFWNDINCGYPNAFICQRHNSSINATVMPTTASTPGGCKEGWNWYNNKCFKIFG
FVQEERKNWQDARKACIGYKGNLVSIQNEKEQAFLTYHMKDSTFNAWTGLNDINSEHTFL
WTNGRGVHYTNWGKGYPGGRRSSLSYEDADCVVIIGGKSRDAGSWMDDTCDSKQGYICQT
ESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXTNNEYTWTDKWRMRYTNWAADEPKLKSACVYLDVDGYWKT
SYCNESFYFLCKRSDEIPATEPPQLPGRCPESEHTAWIPFHGHCYYIESSFTRNWGQASL
ECLRMDSSLVYESTAESSFLSYRVEPLKSKTNFWIGMYRNVEGKWLWINNSPVSFVNWNT
GDPSGERNDCVVLKASSGTWNNIHCTSYKGFICKKPKIVDAETTHTSVTTKXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXHAIV
Download sequence
Identical sequences ENSDORP00000013660 ENSDORP00000013660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]