SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013712 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013712
Domain Number 1 Region: 210-341
Classification Level Classification E-value
Superfamily C-type lectin-like 4.47e-19
Family C-type lectin domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013712
Domain Number - Region: 124-217
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0186
Family Extended AAA-ATPase domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013712   Gene: ENSDORG00000014579   Transcript: ENSDORT00000014579
Sequence length 348
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6544:31805:38899:-1 gene:ENSDORG00000014579 transcript:ENSDORT00000014579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAITYADLRFVKAPLKKSVSSRLEQDPEDYEDGELTYENVQVPPVPAGAPSLASSGPA
DTARVKAKQPAKRCMKLSASQVLPCPTSTSCLQYLLLGLLLTCLLLGVATICLGVSYLQL
SQQFQQVTRILAATNSSLRQQLRERITKLGQQEENLQEYRRQLSQSQEMLQEEQRVHQVA
EQQLQACQLDREQTKETLKREEEQRQALDQRLNSMQNRLKSFSTCSTLDSCCPVGWMQHQ
KSCFYFSHFQKTWDESQKYCTSLSSKLATFHEDTTFSMREFLSNMNIYSYWAKSKAQWIS
NSQHFGTHHKNPKCPKVQMWSWPRITEEKCTETLFFICERETFRSPDE
Download sequence
Identical sequences ENSDORP00000013712 ENSDORP00000013712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]