SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013721 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013721
Domain Number 1 Region: 342-397
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000719
Family TSP-1 type 1 repeat 0.00034
Further Details:      
 
Domain Number 2 Region: 397-452
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000327
Family TSP-1 type 1 repeat 0.00052
Further Details:      
 
Domain Number 3 Region: 294-337
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000107
Family TSP-1 type 1 repeat 0.00087
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013721
Domain Number - Region: 43-128
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00359
Family Spermadhesin, CUB domain 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013721   Gene: ENSDORG00000014588   Transcript: ENSDORT00000014588
Sequence length 1458
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2962:211:222410:1 gene:ENSDORG00000014588 transcript:ENSDORT00000014588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVGELLISIFSTYLLVMFGFNAAQDFWCSTLVKGVIYGSYSVSEMFPKNFTNCTWTLE
NPDPTKYSIYLKFSKKDLSCSNFSLLAYQFDHFSHEKIKDLLRKNHSIMQLCDSKNAFVF
VQYDKNFIQIRRVFPAEFPGSQRKGDHDQKSFFEFLVLNKVSPSQFGCQVLCTWLESCLK
SENGRAESCGAMYTKCSCPQHLGELGGDDQASVVLLSNVVLPLNEQTEGCLTQELQTTQM
CNLTREARPPKEEFGMMRDHTIKSQRPRSVHEKRVPQEPADAAKFMAQTGESGVEDWSPW
SPCSVTCGQGSQVRTRTCVSPFGTHCSGPLRESRVCNNTALCPVHGVWEEWSPWSLCSFT
CGRGQRTRTRACSPPQYGGRPCEGPETHHKPCNIALCPVDGQWQEWSSWSQCSVTCSNGT
QQRSRQCTAAAHGGSECRGPWAESRECYNPECTXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXPYEICPEDYLISMVWRRTPADLAFNQCPLNA
TGTTSRRCSLSLQGVAFWEQPSFARCISNDYRLLQHSIKEHLAKGQRTLAGDGMSQVTKT
LLDLTQRKNFYAGDLLMSVEILRNVTDTFKRASYVPGSDGVQNFFQIVSNLLDEENKEKW
EDAQQIYPGSIELMQVIEDFIHVVGVGMMDFQNSYLMTGNVVASIQKLPAASVLTDINFP
MKGRKGMVDWARNSEDRVLIPKSIFSPVSSKELDESSVFVLGAVLYKNLDLILPTLRNYT
VVNSKIIVVTIRPEPKATDSFLEIELAHLANXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXIMESSGTPSVTLIVGSGLSCLALITLAVVYAA
LWXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSICTTTTAFLHFFFLASFCWVLT
EAWQSYMAVTGKIRTRLIRKRFLCLGWXXXXXXXXXXXXXXXXXXXXXXXXCWLSLEGGL
LYAFVGPAAAVVLVNMVIGILVFNKLVSRDGILDKKLKHRASQMSEPHSGLTLRCAKCGV
VSTTALSATTASNAMASLWSSCVVLPLLALTWMSAVLAMTDKRSILFQILFAVFDSLQGF
VIVMVHCILRREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTDFEKDVDIACRSVLH
KDLGPCRTATITGTLSRISLNDDEEDKGAAPEGLSYSTLPGNVLSKVVLQQPAPLHVPMG
RGELGAPCLPEGGELRRTVYLCTDEDLRGAERDLGHPQDRVLDSDYIVMPRGSVSAPPPT
KDESKMNLGMDTLPHERLLHYKVSPDFSMAPPVMEQFGGNLDQHLAPREHMQSMAFEPRT
AVKNFMAAELDEGAGLSRSETGSTISMSSLERRKSRYSDLDFEKVMHTRKRHMELFQELN
QKFQTLDRFRDIPNTSSM
Download sequence
Identical sequences ENSDORP00000013721 ENSDORP00000013721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]