SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013731 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013731
Domain Number 1 Region: 892-994
Classification Level Classification E-value
Superfamily SEA domain 0.0000000000353
Family SEA domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013731
Domain Number - Region: 1042-1084
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0371
Family EGF-type module 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013731   Gene: ENSDORG00000014596   Transcript: ENSDORT00000014599
Sequence length 1222
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_722:37354:87225:-1 gene:ENSDORG00000014596 transcript:ENSDORT00000014599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIMFPLFGKISLHILIFFLIEGIVTSLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCQEAVWEA
FRTFWDRLPEREEYRYWMDLCEDGITSIFEMGTNFSQSVEHRSLLMKKLTYTEETISSSE
LSSPVPADDTSTLIXXXXXXXXXXXXXXXXXXXXXXXXXXXXISNEIENVVEEPTKPATE
QIAEFSIHLLGRQYREELKDPASFHHQHLAEEFIAEXXXXXXXXXXXXXXXXXXXXSPKE
NGSGIDVLYTVTFNAEAISNTTWDLISLHSNKVENHGLVEMDDKPTAVYTISNFRDYIAE
TLHQNFLLGNSSLNPDPESLQLINVRGVLLPQTEDSVLNTQSSSFHSTPPSILDNTIPAE
WPSADESTTSKISPLGFSSGPPSTTGRELWSESALSDLVSTSKLVFPSELGLSSSPEVLD
VSRLTLHSVTPAVQTVXXXXXXXXXXXXXXXXXXXLANIEESNVLSTDSLPSSAFVQPVP
KGTIPSIEDSVVSLTSSPYLTSSMTFELGSLASKVTDHLEVGPLFPDTSVGKEVIFESGL
GSGSGQKEDLITWPWSETSLDKSTEPLSKPWFEDEDSLLPIKGRGEKLHTDGEMDSTDLI
IEQSKHSQDDRHIFAETEDLSGPTTIPTFVESVTQSASLIFSKHISEVSDIEHYSVTKAP
LLQTSIASSASAEKTEQVDVFLQEHIEQTTDSSGHELLDSKVSEVKADLQSVWTVLPEAD
IVWTRTSLEKLSRDTVASTLMSTDRPWLKSSMTQSTKLPSTTSSTLLEDEVIMGVQDISL
ELDRVGTDYYQPELIQEQNGKLGSYVEISTEKPIVAQPTKGGDKGDTQTTGALVVFFSLR
VTNMMFSEDLFNKNSLEYKALEQRFLELLVPYQSLTGQFRILNFRNSVVNSRMRLKSTLN
VNNAVYILEDFCTTAYQTMNLDIDKYSLDVESGDEANPCKFQACNEFSECLVNSWSGEAK
CRCFPGYLSIDDLPCQSLCNLQPDFCLNDGKCDIMPGHGAICRCRVGENWWYRGEHCEEF
VSEPLVIGITIASVVGLLFISSVVIFFFVKTLQAQNNRRERERPSXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEIQE
RMRILELYANDPEFAAFVREHQ
Download sequence
Identical sequences ENSDORP00000013731 ENSDORP00000013731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]