SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013733 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013733
Domain Number 1 Region: 687-740
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000865
Family Laminin-type module 0.00062
Further Details:      
 
Domain Number 2 Region: 743-791
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000012
Family Laminin-type module 0.0011
Further Details:      
 
Domain Number 3 Region: 794-841
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000243
Family Laminin-type module 0.0072
Further Details:      
 
Domain Number 4 Region: 305-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000977
Family Laminin-type module 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013733
Domain Number - Region: 548-586
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00307
Family EGF-type module 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013733   Gene: ENSDORG00000014599   Transcript: ENSDORT00000014601
Sequence length 1455
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_304:8389:43694:1 gene:ENSDORG00000014599 transcript:ENSDORT00000014601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KAYEITYVRLKFHTSRPESFAIYKRSRAGGPWEPYQYYSASCQRTYGRPEGQRLRPGQDE
RVAFCTSEFSDISPLSGGNVAFSTLEGRPSAYNFEESPGLQDWVTSTELLISLDRLNTFG
DDIFKDPKVLQSYYYAVSDFSVGGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXPCMCSAAGSLGTCDPRSGHCPCKDNVEGNLCDRCRPGTFNLQPYNPTGCTPCFCFGH
STVCAVAPGFQTQPVISDFRQGADGWRATGSGGSERSPRWSPSGVLLGPGDEELRAPERF
LGDQRLSYGQPLTLTLRVPPGAPPPPVRLKLGGAGLDLALKPSSSSGPPGAGQPGLLQLH
FLLQETSEDAGPPLPAFHFQRLLTNLTVLGIRASGQGTSTSGQVFLTEVQLPSVQPGPGP
APPAAWVEACSCPRGYTGQFCESCAPGYKRETPQGGPYTRCVPCTCNQHGTCNPNTXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
RRCEQCEDGFFGDPLGGRGAPQPCRPCPCSGNVDPNAVGNCDPQSGRCLRCLHNTTGPRC
ERCREGFYGSALALRPADKCTPCSCHPGGSASELRPCHPVTGQCTCLSHVTGRDCGHCRP
GFYDLQPGRGCQSCKCHPLGSQENRCHPETGQCPCRPGVTGQACDRCQLGFFSFSAKGCR
ACCSPLAASAQCHENSTCVCPGFAGYCDRCQSNXXXXXXXXXXXXXXXXXXXXXXXVAKL
KARLALVEEWLQGSDCSSPWEPLDILQEETPRGDAYQRHLLPGAREAFLLQMTGLGRAVR
AAGEQLRALDTSARCDGKTCSQLADLRVALAASEEEILQAASVLTYLXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLRQEATAALTR
ASAAVHAATVTVTGARTLLADLEGMKPRFPQPRDRATLQRKASVVRGRLLADTKKKTKQA
ERMLGNAASLSSSARKKSREAELLAKDNAKLSKAVLRAGKRGQRRAGGLASQAQATLQQA
SWLARISGARRRELEAAEQVSAGLSSLEQHIRASHISLEKDIKALSELLARLGSLDTDQA
PSQALNETQRALDSLRLQLGSQGALHRRLQQLEQESEQQKQQIQDFENDLTEIRADKQNL
EAILHSLPEPCSSWQ
Download sequence
Identical sequences ENSDORP00000013733 ENSDORP00000013733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]