SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013748 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013748
Domain Number 1 Region: 242-301
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.87e-22
Family Eukaryotic proteases 0.0046
Further Details:      
 
Domain Number 2 Region: 155-205
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000196
Family Scavenger receptor cysteine-rich (SRCR) domain 0.043
Further Details:      
 
Domain Number 3 Region: 134-158
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000942
Family LDL receptor-like module 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013748
Domain Number - Region: 359-390
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000316
Family Eukaryotic proteases 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013748   Gene: ENSDORG00000014616   Transcript: ENSDORT00000014616
Sequence length 391
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3146:646:11951:-1 gene:ENSDORG00000014616 transcript:ENSDORT00000014616 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NASPARTSSPGRTVPARASPAYASPAQAFPSRSSSVGSSSSPRSTCATSPSRVYLVRATA
LGAVPVRASPARPAPATRESSGPSLPKFSWKETQKQLPLIACILLLIALVVSLILLFYFW
RGHTGIKYKEPVESCPKHTVRCDGVVDCKLKSDELGCVRFDWDRSLLKVYSAASHEWLPV
CSSSWNDSDSKKTCQQLGFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXCGLRAMTGRIVGGALASESKWPWQVSLHFGTTHICGGTLIDAQWVLTAAHCFF
VXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXH
IHPACLPMHGQTFSLNETCWITGFGKTKETD
Download sequence
Identical sequences ENSDORP00000013748 ENSDORP00000013748

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]