SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013760 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013760
Domain Number 1 Region: 517-571
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000391
Family Laminin-type module 0.00018
Further Details:      
 
Domain Number 2 Region: 462-519
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000046
Family Laminin-type module 0.00098
Further Details:      
 
Domain Number 3 Region: 139-184
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 4 Region: 94-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000391
Family Laminin-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013760
Domain Number - Region: 379-418
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00128
Family EGF-type module 0.09
Further Details:      
 
Domain Number - Region: 649-735
Classification Level Classification E-value
Superfamily Tropomyosin 0.0183
Family Tropomyosin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013760   Gene: ENSDORG00000014628   Transcript: ENSDORT00000014628
Sequence length 1107
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_364:9717:71601:1 gene:ENSDORG00000014628 transcript:ENSDORT00000014628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPALWLSCCLCVSLLLPAARATSRREXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLSVQCDNSGQCSCKPGVTGERCDRCLPGF
HTLTDAGCTPDQNLLNRKCDCDPAGIAGPCDSGHCVCKPAVTGERCDRCKPGYYHLDRGN
PEGCTQCFCYGHSGSCRSSVDFSVHKITXXXXXXVDGWKAVQKNGSPAKLHWSHRHRDVF
SSARHSDPVYFVAPAKFLGNQQVSYGQTLSFDYRVDRGGRHPSSHDVILEGAGLRITAPM
MPLGKTLPCGLTKTYTFRLSEHPSSNWSPQLSYFEYRRLLRNLTALRIRATYGEYSTGYL
DNVTLISARPVSGAPAPWVEHCVCPVGYKGQFCQDCASGYKRDSAKLGPFGSCIPCNCQG
GGTCDPDTGDCYSGDESPDIECADCPIGFYNDPHDPRSCKPCPCHNGFSCSVMPETEEVV
CSNCPPGVTGARCELCADGYFGDPFGEHGPVRPCQPCQCNHNVDPSASGNCDRLTGRCLK
CIHNTAGFYCDQCKAGYFGDPLAPNPADKCRACNCNPMGAEPGECHSDGSCVCKPGFGGV
NCEHAALTSCPACYNQVKMQLGPFMQQLQSLEALVSQTQGSGGTVLNSELEGRMQQAEQA
LQDILREAQIAEDARRSLSLQVAKVRGQENSYQSRLDDLRRTAERIQALSSQHQNQVQDT
RRLITEMRLSLTESEASLRNAXXXXXXXXXXXXXXXXXXXXXXXXXXXHAESASNMEQLA
RETEDFSKQALALARQAVNGGGGSDISDSSVVQGLMGXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXVEAKRIRQKADSLSSLVTRHMDEFKLVQSNLGNW
EKEMRQLLQSGKDGRQKAGQLLSRANLAKSRAQEALSMGNGTFYEVESILKNLRXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XEIGSLNLEANVTADGALAMEKGLANLKSDIREVEGELARKELEFDADKDAVQMVITEAQ
RVETRAKNAGITIQDTLEALDGILHLI
Download sequence
Identical sequences ENSDORP00000013760 ENSDORP00000013760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]