SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013778 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013778
Domain Number 1 Region: 1-36
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.0000759
Family CSE2-like 0.066
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013778
Domain Number - Region: 73-111
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 0.000157
Family CSE2-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013778   Gene: ENSDORG00000014647   Transcript: ENSDORT00000014647
Sequence length 129
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1755:1288:3175:1 gene:ENSDORG00000014647 transcript:ENSDORT00000014647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LADQFCNAIGVLQQCGPPTSFNNIQSAINKDQPANPTEXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXAASLYKLEEENHEAATCLEDVVYRGDLLLEKIQSALADIAQSQLKTRS
GAHTQPFPY
Download sequence
Identical sequences ENSDORP00000013778 ENSDORP00000013778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]