SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013787 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013787
Domain Number 1 Region: 177-410
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.62e-72
Family Eukaryotic proteases 0.00017
Further Details:      
 
Domain Number 2 Region: 33-144
Classification Level Classification E-value
Superfamily SEA domain 3.4e-18
Family SEA domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013787   Gene: ENSDORG00000014653   Transcript: ENSDORT00000014656
Sequence length 411
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6089:716:9830:-1 gene:ENSDORG00000014653 transcript:ENSDORT00000014656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNISFQRTSWPLWIIFSILGTMVILGVTIGLLVHFLAVGKMYYYQGDFHISGVTYNSSCE
TTASQANTDLSRDMEAKMLSVFQNSRIFKEYVSSQIINFLPHPNGSRVQLHMTFKFPPER
VSMRSKIRAILQQMLKDNMATWKAVPTSIKIIEISKFKSDMLVNNCCGRPVVNSIATGNR
VVNGKNAQEGAWPWMASIQWRGTHFCGASLISSRWLLSAAHCFVKKTSLKDWTVNFGLVV
NKPYITHKVRRIILHEHFKSAGVHNDIALVELANEVSFTKYIRKICLPEASMKLSEQDKV
VVTGWGALSMNGSFPVIQEAPLKIIDNEICNAPHVLSGLVLDTMLCAGYLSGEADACQXX
XXXXXXXXXXXKIWHIVGIVSWGEGCAKKNKPGVYTRVSSYHDWIISKTGL
Download sequence
Identical sequences ENSDORP00000013787 ENSDORP00000013787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]