SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013796 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013796
Domain Number 1 Region: 1-209,300-334
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.3e-20
Family FAD-linked reductases, N-terminal domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013796   Gene: ENSDORG00000014665   Transcript: ENSDORT00000014665
Sequence length 342
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6826:131748:1219150:-1 gene:ENSDORG00000014665 transcript:ENSDORT00000014665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARVLIVGAGLTGSLCAALLRKEVTGPLHLAVWDKAGDSGGRMTTASSPHNPQCTADLGA
QYITCTPHYAKQHQNFYDELLALGILAPLAASIEGMRVNEGDCNFVAPQGISSIIKHYLK
KSGAEVYFRQCVTRINLHNNKWEVSKETGSPEIFDLVVLTMPVPEILQLQGDIVDIISEC
QRQQLESVSYSSRYALGLFYEAGTKIDVPWGGKYITSNPCVRFISVDNKKRNIXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTNAAAKY
PGQMTLHCSPLLVCGGDGFTQSNFDGCITSALCVLEALKNHT
Download sequence
Identical sequences ENSDORP00000013796 ENSDORP00000013796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]