SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013812 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013812
Domain Number 1 Region: 22-295
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.2e-48
Family Ankyrin repeat 0.00022
Further Details:      
 
Domain Number 2 Region: 373-421
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000288
Family SOCS box-like 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000013812
Domain Number - Region: 303-411
Classification Level Classification E-value
Superfamily Poly A polymerase C-terminal region-like 0.0902
Family Poly A polymerase C-terminal region-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013812   Gene: ENSDORG00000014681   Transcript: ENSDORT00000014681
Sequence length 426
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2509:120139:169109:1 gene:ENSDORG00000014681 transcript:ENSDORT00000014681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGNTAPITKSGAAKLVKRKFLEALKSNDFGKLKAILIQRLIDVDTVFEVEDENMVLASY
KQGYWLPSYKLKSSWATGLHISVLFGHVECLLVLLDHNATINCRPNGKTPLHVACEMANL
DCVKILCDRGAKLNCYSLSGHTALHFCTTPSSILCAKQLVWKGANVNMKTNNQDEETPLH
TAAHFGLSELVAFYVEHGAVVDSVNAHMETPLAVAAYWSLRFKEQEYSREHHLICRTLLD
HHAEVNARDDDFKSPLHKAAWNCDHVLMHMMLEAGAEANLMDINGCAAIQYVLKVTSVRP
AARPEVCYQLLLNHGAARIYPPQFHKVIQACHSCPKAIEVVVNAYEHIRWNIKWRRAIPD
DDLEKYWDFYHSLFMVCCNTPRTLMHLSRCAIRKALHNRCHKAIPLLSLPLSLKKYLLLE
PEGIIY
Download sequence
Identical sequences A0A1S3GSR9
ENSDORP00000013812 ENSDORP00000013812 XP_012891319.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]