SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013819 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013819
Domain Number 1 Region: 172-471
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.04e-77
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000607
Further Details:      
 
Domain Number 2 Region: 38-82
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000000156
Family Anticodon-binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013819   Gene: ENSDORG00000014688   Transcript: ENSDORT00000014688
Sequence length 477
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3128:5174:107762:-1 gene:ENSDORG00000014688 transcript:ENSDORT00000014688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGARGLLRALRSCSTVSCPRPRASVKLSVRDALRSHGALGERVKVQGWIRSTRSQKEVL
FLHINDGSSLESLQVVADSSFDNXXXXXXXXXXXXXXXXXXXXXXXXXELKAEKIEVIGN
CDVKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDSGFVHIHT
PIITSNDCEGAGELFCVEPLSKINVPKGKFFDVPAFLTVSGQLHLEVMAGAFTQVFTFGP
TFRAENSQSRRHLAEFYMVEAEISFVETLQDLMQVMEELFKTTTTMILSNCPEDVELCHK
YIDPGQKDRLEHMLKNNFLTISYTEAVEILKQASQNFTFTPEWGADLQTEHEKYLVQHCG
NIPVFIINYPRALKPFYMRDNEDGPQHTVAAVDLLVPGVGELFGGSLREERYHFLEQQLA
RSGLTEAYQWYLDLRQFGSVPHGGFGMGFERYLQCILGIANIKDVIPFPRFTHSCLL
Download sequence
Identical sequences ENSDORP00000013819 ENSDORP00000013819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]