SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013933 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013933
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 2.78e-24
Family UDPGT-like 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013933   Gene: ENSDORG00000014813   Transcript: ENSDORT00000014811
Sequence length 93
Comment pep:novel scaffold:dipOrd1:scaffold_3119:28438:31830:-1 gene:ENSDORG00000014813 transcript:ENSDORT00000014811 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPTTLMETMSKAEIWLIRSYWDLEFPRPTLPNVDFVGGLHCKPAKPLPKEMEDFVQSSGD
SGVVVLSMGSMVDNITEETANEIASALAQVPQK
Download sequence
Identical sequences ENSDORP00000013933 ENSDORP00000013933

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]