SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013942 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013942
Domain Number 1 Region: 163-374
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.98e-54
Family Ankyrin repeat 0.00011
Further Details:      
 
Domain Number 2 Region: 2-132
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.44e-40
Family Ankyrin repeat 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013942   Gene: ENSDORG00000014817   Transcript: ENSDORT00000014820
Sequence length 1705
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1985:33606:107145:-1 gene:ENSDORG00000014817 transcript:ENSDORT00000014820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CGQTPLMIAAEQGNLEIVKELIKNGANCNLEDLDNWTALISASKEGHIHVVEELLKCGVN
LEHRDMGGWTALMWACYKGRTDVVELLLSHGANPSVTGLYSVYPIIWAAGRGHADIVHLL
LQNGAKVNCSDKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNSMTALIVAVKGGYT
QSVKEILKRNPNVNLTDKDGNTALMIASKEGHTEIVQDLLDAGTYVNIPDRSGDTVLIGA
VRGGHVEIVRALLQKYADIDIRGQDNKTALYWAVEKGNATMVRDILQCNPDTEICTKDGE
TPLIKATKMRNIEVVELLLDKGAKVSAADKKGDTPLHIAIRGRSRKLAELLLRNPKDGRL
LYRPNKAGETPYNIDCSHQKSILTQIFGARHLSPTETDGDMLGYDLYSSALADILSEPTM
QPPICVGLYAQWGSGKSFLLKKLEXXXXXXXXXXXXXXXXXXXXXXXXXLLLCGGLGLLF
AFTVDLNLGIAVSLSFLALLYIFFVVIYFGGRREGESWNWAWVLSTRLARHIGYLELLFK
LMFVNPPELPEQTTKALPVRFLFTDYNRLCSVGGETSLAEMIATLSDACEREFGFLATRL
FRVFKTEDSQGKKKWKKTCCLPSFIIFLFILGCIIAGITLLAIFRVDPKHLTVNAVLIAI
ASIVGLAFVLNCRTWWQVLDSLLNSQRKRLHSAASKLHKLKSEGFMKVLKCEVELMARMA
KTIDSFTQNQTRLVVIIDGLDACEQDKVLQMLDTVRVLFSKGPFIAIFASDPHIIIKAIN
QNLNSVLRDSNINGHDYMRNIVHLPVFLNSRGLSNARKFLVTSATNGDISCSDATGIQED
ADRRVSQNSLGGEMTKLGSKTALNRRDTYRRRQMQRTITRQMSFDLTKLLVTEDWFSDIS
PQTMRRLLNIVSVTRLLRANQITFNWDRLASWINLTEQWPYRTSWLILYLEETEGVPDQL
TLKTIYEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXVRAAREQMNIGGLAYPPLPLHEAPARPASGYSQPPSVCSSSTSFNGPFAGGV
VSPQPHSSYYSGLTGPQHPFYNRPFFAPSLYTPRYYPGGSQHLISRSSVKPSLPRDQNNG
LEVIKEDAAEGLSSPTDSSRGSGPATGTVLSLNAMTVDTVCEKLRQIEGLDQSMLPQYCA
TIKKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSQTR
RTPSLSSLNSQDSSIEISKLTDKVQAEYRDAYREYIAQMSQLEGGTGSATISGRSSPHST
YYMGQSSSGGSIHSNLEQEKGKESEPKQDDGRKSFLMKRGDVIDYSSSGVSTNDASPLDP
ITEEDEKSDQSGSKLLPGKKSSERSSLFQTDLKLKGGGLRYQKLPSDEDESGTEESDNTP
LLKDDKDKKAEGKAERVSKSPEHTAEPIRTFIKAKEYLSDALLDKKDSSDSGVRSNESSP
NHSLHNEATDGSQLEKANLIELEDDTHTGKRGMPHSLSGLHDPIIARMSICSEDKKSPSE
CSLIASSPEESWPACQKTYNLNRTPSTVTLNNNTAPATRPNQHFDEMEGIRESSQVMLMP
GPTPTTIQNENLKSLTHRRSLRSSY
Download sequence
Identical sequences ENSDORP00000013942 ENSDORP00000013942

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]