SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013944 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013944
Domain Number 1 Region: 26-257
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.24e-48
Family Eukaryotic proteases 0.0000103
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013944   Gene: ENSDORG00000014822   Transcript: ENSDORT00000014822
Sequence length 257
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_64:40239:44548:-1 gene:ENSDORG00000014822 transcript:ENSDORT00000014822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLALALLSSLALAAPAPSPAMGRAGIVGGQEAPKNTWPWQVSLRVHLVYWKHICGGSL
IHPQWVLTAAHCVGPRILPPELLRGQIRQHHLYYRDRLLPVRPFHPHPDYYSATSDVTLL
DLEEPLKVSGREMTMSLPHTSDTPRTPCWATGRGMFHEXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGDSGGPLVCDVGVWVQVGVVSWGSECA
LPRRPGVYTNVSYYTAW
Download sequence
Identical sequences ENSDORP00000013944 ENSDORP00000013944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]