SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000013968 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000013968
Domain Number 1 Region: 866-1117
Classification Level Classification E-value
Superfamily SET domain 1.2e-82
Family Histone lysine methyltransferases 0.0000301
Further Details:      
 
Domain Number 2 Region: 710-843
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-28
Family Ankyrin repeat 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000013968   Gene: ENSDORG00000014847   Transcript: ENSDORT00000014847
Sequence length 1157
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_5806:1152:66493:1 gene:ENSDORG00000014847 transcript:ENSDORT00000014847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADEASTEKQAGEAPAAADGETNGSFEKSSDTSHLNVAKHTQENARASPQDSNNRAPRI
SENGVSERDIEVEKQNHVTADDLMQTSVIGSNGYFLNKPALQGQPLRTPNTLASSLPGHA
AKTLPGGASKGRTSSGLLQTPAAAPAVPGAGSADTEDRKPAAPASDVRIHRARKTMPKSV
LGLHVANKDPREFREARDHKEPKEEINRNISDCGRQQLLPPFPSLHPSLPQNQCYVATTK
SQTACLPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXSSESSIKKKFLKRRGKTDSPWIKPARKRRRRSRKK
PSGVPGSEACKSSPGSTEQMAPGDSTGYMEVSLDSLDLRVRGILSSQVERLANGPDALET
DGLQEVPLCSCRMETPKSREISTLANNQCMATESVDHELGRCTNSVVKYELMRPSTKAPL
LVLCEDHRGRMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASRVNNASYCPHCG
EETSKAKEVTIAKADTTSTVMLAPGQEKSMVTEGRADTTTGXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPKKLRFHPKQLYFSARQGEL
QKVLLMLVDGIDPNFKMEHQNKRSPLHAAAEAGHVDICHMLVQEENICLHWAAFSGCVDI
AEILLAAKCDLHAVNIHGDSPLHIAARENRYDCVVLFLSRDSDVTLKNKEGETPLQCASL
NSQVWSALQMSKALQDAAPDKPVAVEKTMSRDIARGYERIPIPCVNAVDSEPCPTNYKYV
SQNCVTSPMSIDRNITHLQYCVCVDDCSSSTCMCGQLSMRCWYNKDGRLLPEFNMAEPPL
IFECNHACSCWRNCRNRVVQNGLRARLQLYRTQDMGWGVRSLQDIPLGTFVCEYVGELIS
DTEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMSHQDLRF
PRIAFFSTRLIQAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHSSAALAQRQASAAQEA
QENGLPDTSSAAALDPL
Download sequence
Identical sequences ENSDORP00000013968 ENSDORP00000013968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]