SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014001 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014001
Domain Number 1 Region: 538-582
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000405
Family TSP-1 type 1 repeat 0.00093
Further Details:      
 
Domain Number 2 Region: 89-130
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000127
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 3 Region: 37-85
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000654
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014001
Domain Number - Region: 493-530
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0119
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014001   Gene: ENSDORG00000014884   Transcript: ENSDORT00000014882
Sequence length 583
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_3990:8222:60118:-1 gene:ENSDORG00000014884 transcript:ENSDORT00000014882 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFATAFFILSLMTGQPGIIAQEKVNRRISRAVSPAAVACQLSNWSEWTDCFPCQDKKYRY
RSLLQPSKFGGAICSGDIWDHASCYSSAPCLQQAQCGQDFQCKETGRCLKRHLVCNGDRD
CLDGSDEEDCEDVRASADDCSQYEPIPGSDRVALGYNILTQKETQSVYDARYYGGQCETV
YNGEWRELRYDPTCERLYYGEDEKYFRKPYNFLKYHFEPLADTGISSELYDDVNDLLSKV
KNEKFQSSGLTLGIGPADRSVMVNVGVSQSDEASFLKKLNKYNKKRYNFMRIFTKVQTAH
FKMRRHDIMLDEGMLQSLMELPEQYNYGLYAKFIDDYGTHYITSGSMGGTYEYILVLDRE
KMELFGITDSYIKTCIGGAIGFDSDDNIKIEGCLLGERCEKVGSGLGTKDQKAMGVEDII
SRVQGGSSGWGGALTQNISTTTYRSWGRSLKYNPVVIDFEVQPIHELLRHTNLGLLETKR
QNLRGALDQYLMEFNACRCGPCFNNGEPILEGTSCQCLCGPGHQGLACEQIELQDAKVDG
RWSCWSSWSECTAGTQERRRECNNPTPQNGGAPCPGRRVQTQC
Download sequence
Identical sequences ENSDORP00000014001 ENSDORP00000014001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]