SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014003 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014003
Domain Number 1 Region: 975-1126
Classification Level Classification E-value
Superfamily FAS1 domain 4.58e-26
Family FAS1 domain 0.0022
Further Details:      
 
Domain Number 2 Region: 1739-1845,2414-2448
Classification Level Classification E-value
Superfamily FAS1 domain 8.63e-26
Family FAS1 domain 0.0033
Further Details:      
 
Domain Number 3 Region: 1575-1723
Classification Level Classification E-value
Superfamily FAS1 domain 1.05e-24
Family FAS1 domain 0.0012
Further Details:      
 
Domain Number 4 Region: 486-652
Classification Level Classification E-value
Superfamily FAS1 domain 1.96e-22
Family FAS1 domain 0.0014
Further Details:      
 
Domain Number 5 Region: 1135-1262
Classification Level Classification E-value
Superfamily FAS1 domain 3.79e-21
Family FAS1 domain 0.0041
Further Details:      
 
Domain Number 6 Region: 2188-2238
Classification Level Classification E-value
Superfamily C-type lectin-like 0.000000000706
Family Link domain 0.0096
Further Details:      
 
Domain Number 7 Region: 875-990
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000314
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 8 Region: 237-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000323
Family EGF-type module 0.028
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014003
Domain Number - Region: 2085-2122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000263
Family EGF-type module 0.053
Further Details:      
 
Domain Number - Region: 2131-2164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000433
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 1434-1467
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00467
Family EGF-type module 0.091
Further Details:      
 
Domain Number - Region: 1513-1535
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00526
Family Merozoite surface protein 1 (MSP-1) 0.04
Further Details:      
 
Domain Number - Region: 325-362
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00837
Family EGF-type module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014003   Gene: ENSDORG00000014881   Transcript: ENSDORT00000014884
Sequence length 2546
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3026:40264:157485:1 gene:ENSDORG00000014881 transcript:ENSDORT00000014884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMLQYLQLFLLGWLVQVSSSQTESPGQAKRCDKESVLTTRTQCKSCWLNLGIKCPDGYTK
ITNNSVGVRDCRYNYDVKSYFWPLPGCRHICRKNYLQPQCCPGHWGPDCQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXEGFGGTACEMCADDNLFGPNCSSXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXINP
CLQNICHPHALCTYLGPNRHRCSCQEGYHGDGQVCLPIDPCQTHFGNCPTQSTVCKYDGP
GQSHCECKEHYHNFVPGVGCSMINICESKNPCHRNANCTTIIPGQTKCTCREGYVGDGLL
CYGNIMERLRELNTEPRGKCQGRLTSVISLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDGQLRLKLYGG
KKKVQIVQGNIVAANGLIHILDQAMDSIQPTFVSNTKXXXXXXXXXXXXXXXXXXXEANM
GHSFDEDGPYTVFVPSNEALESMKDGTLDYLLSPQGSRKLLELVRYHIIPFTQLEVANVV
STPHIRSMANQNIQFNTTSNGQILANEVAMDETEITAKNGRIYTLTGVLIPPSIIPILPH
LCNETRRETKLGTCVNCYLIHRSKCPADSQISRFYIHKCVYRSTLGGLKSGCALRCSAIV
QVPKCCKGFYGPDCNPCLGGFLNPCSGNGQCADGLQGNGTCICKDGFQGSQCQFCSDPNK
YGPQCNQTCPCVHGVCDNRIDSNGTCLPGTCREGTAGTFCDRQTSTCGPYVQLCHIHATC
IYSNGTAXXXXXXXXXXXXXXXXXXXXXXGPTRGGCSHNSECIKTKAGTHTCVCQQGWTG
NGRDCVEINNCLLPGAGGCHANATCLHVGPGQNECECKKGFRGNGIDCEPIISCLEQTEK
CHPLATCRFVSSGVWSCVCQEGYEGDGFLCYGNAAMELSFLSDAVIFNQWINNASFQSML
STTLNLTILVPSKQAIEDMDPKEKTFWLSKNNIEALIKHHMLVGTYRVADLQTLSPSDTV
ATSLQGSFLRLDQADGNITIGGASILDGDNVATNGVIHVINKVLVPLRGLSGYLPNLLTR
LDQMPDYSIFRGYMIQYNLVNQVEAADAYTVFAPNNNAIERYVKEKKVSTLEEDIIRYHV
VLEEKLLKNDLHNGMHRETMLGFSYLLGFFLHDDQLYVNEAPINYTNVATNKGVIHGLGK
VLEIQKNRCDINDTTIVRXXXXXXXXXXXXXXXXXXXGNETRKCIYTIYFMGRRNVFIGC
QAKCVKTVITRACCAGFFGPQCQACPGKGQNVCFGNGICLDGVNGTGKCECGPGFSGTAC
ETCAQGKYGIHCDQVCPCVHGRCNQGPSGDGSCDCDIGWRGVACDREITKDDCNGTCHTS
ANCLLNLDGTASCKCAAGFQGNGTICTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXINPCLENHGGCDKNAECTQTGPNQXXXXXXXXXXXXXXXXXXXXXXXXNN
GGCSPFAVCNHTGGDERTCTCKMNYTGDGITCRGSIYKXXXXXXXXXXXXXXXXVHAVRE
LAGPGPFTVFAPSSYSFSEEPRLADWNQQGVIPQILRYHMVACQQLLLENLKSISHVTSL
QGELLSISVSQDTVYINNKAKVIASNIISNNGVIHVIDKLLSPQNLVITPRDTSGRILQN
LTTTAINHGYHRFAKLIQDSGLLSTITEPIHIPVTLFWPTDQALQALPAKQQEFLFNPLN
KDKLEEYLKFHVIRDAKALAIDLLRSDSWKTLQGSELRVTCGTGNDTGELFLNDQMCRIV
QRGLQFDVGVTYGIDCLLLDPTLGGRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGKKQK
CLYHLLQPYRRNLEGCQNLCALVVQIPTCCKGYYLPDCQACPGGPDLPCNNQGVCINLLS
ASRQCQCNEGFNGTACNLCLPGRFGPHCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXSAPVCTPPCSAQATCMENNTCECNLNYEGDGLTCTAVDFCKQNNGGCAKVAKCSQ
KNTTVSCSCPTGFRGDGYTCLEIDSCADGLNGGCHEHAICTMIGRGRHKCRCKDHYVGDG
LNCEPEQLPLDRCLQDNGQCHADAHCADLHFQDTTVGVFHLRSPLGQYKLTFDKAKEACA
NEAAALATYAQLSYAQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXETRFVDGRTILQWDIFASNGIIHVISKPLKAPPAPATHSGGTGIS
FTIILVIAAIALAAIYXXXXXXXXXXXXXXXSEEDIDVAAFGRQQSENISNPTYESATSE
PSEPSYDPFMDADEQQVESSDPLGAL
Download sequence
Identical sequences ENSDORP00000014003 ENSDORP00000014003

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]