SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014007 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014007
Domain Number 1 Region: 14-103,137-261
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.97e-53
Family Ankyrin repeat 0.00014
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014007
Domain Number - Region: 416-482
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.0131
Family Apolipoprotein A-I 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014007   Gene: ENSDORG00000014887   Transcript: ENSDORT00000014888
Sequence length 724
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2963:7636:56150:1 gene:ENSDORG00000014887 transcript:ENSDORT00000014888 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQQDAVAALSERLLIAAYKGQAENVVQLINKGAKVAVTKHGRTPLHLAANKGHLSVVQI
LLKAGCDLDVQDDGDQTALHRATVVGNTEIIAALVQEGCALDRQDKXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXAGNTALHLACQNSHSQSTRVLLLGGSRADLKNNAGDTCLHV
AARYNHLPIIRLLLSAFCSVHEKNQAGDTALHVAAALNHKKVVKILLEAGADGTIVNNAG
QTPLETARYHNNPEVALLLTKAPQVLRFSRGRSLRKRRERLKEERRAQSVPRDEVAQSKG
SVSAGDTPSSEQAALRKEEAREDFLSASPEPRAKDNRRRKSRPKVSALSDPTPAADQHPG
HQRNFHTHHHPKKKSKHRGSSPPPPHEFKAYQLYTLYRGKDGKVMQAPIDGCRCEPLINK
LENQLEATVEEIKAELAAVQDKMNTKLGQVETKTQHQMRVLDKLMVERLSAERTECLSRL
QQHSDAEKHEGEKRQMSLVDELKTWCMLKIQNLELKLSGDSRTSRAKSTPSTCDSSTGMD
PSVATAGPAVTSDSSSVVRPKKALNSTATXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXEEARSANQKAQQDKAILKEHIKSLEEELAKLRSKV
QKEN
Download sequence
Identical sequences ENSDORP00000014007 ENSDORP00000014007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]