SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014017 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014017
Domain Number 1 Region: 241-416
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.53e-31
Family Reprolysin-like 0.0013
Further Details:      
 
Domain Number 2 Region: 433-496
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0000000000628
Family Blood coagulation inhibitor (disintegrin) 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014017   Gene: ENSDORG00000014898   Transcript: ENSDORT00000014899
Sequence length 727
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2855:348:2841:-1 gene:ENSDORG00000014898 transcript:ENSDORT00000014899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVQFSQDTDLKDQPHTLISSEREARPAIPHVLLHSDISMMPMSEIPVHIRVLLSLWLEIS
LSIPSLSQARPSQHFISPEMVIPLKVISRKGAKALGFLSYSFWFGGQRYIVHMKVKKLLV
STHFPLLTYTEECAIHEEQPFFQDDCHGYVEGIESLVALSTCSGGFRGMLQINHLAYETE
PIRMSATFEHWVYRIESDETQLLFMRCGTEDKLTFLEWQLSYNFTLKRSSVGWTHWWFIE
LLVVDHDRCLFSKSNMSEVLEVFVINIMDFFYKPLEVDIILTMMEIWNNECPFFTSGDID
QVVEYFSVWKHQLNVQLRYDVAHIFIKNKGTRLGIAYVNGICQRPFNCGADVFENRSLFL
FACTMTHELGHTRWCVCALKWAMYAYRRVSSKFSNCNYSQYWDSSSNTGLCIYPLPHPAN
TFRLKYCGNVVVEGEECDCGNIYQCAKDPCCVLNCTLSPGASCASGLRCKDFQFMPSGTW
IQEASECDLPCQEDVYVQDGLPWRVFLKKTCSNHDMQCKEIFGSDAWSASQRCYKEINTQ
GNSFGHYNIVGTIYVKCLAADIMCGRVQCENVHTVPNPVEHSIVYQFHLNNTGCWGTDYH
LGMSIPDVGQVKDGTTRGPGKIYIHKKCASMVCLPQTCQSETCNRVICNNKQHCHCNHRW
APPYSSTKGYGGSEDSGPPPKNGSEESNVKDNSSQLLLLWPIPVIGLFLCCRVLKMQTKR
KEGEEEE
Download sequence
Identical sequences ENSDORP00000014017 ENSDORP00000014017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]