SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014049 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014049
Domain Number 1 Region: 95-387
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.9e-47
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.00000000127
Further Details:      
 
Domain Number 2 Region: 431-553
Classification Level Classification E-value
Superfamily Ricin B-like lectins 3.43e-38
Family Ricin B-like 0.000000709
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014049   Gene: ENSDORG00000014934   Transcript: ENSDORT00000014931
Sequence length 559
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3429:9877:53802:1 gene:ENSDORG00000014934 transcript:ENSDORT00000014931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKFAYCKVVLATSLIWVLLDMFLLLYFSECNKCDEKKERGLPAGDVLEPVQKPHEGPGE
MGKPVVIPKEDQEKMKEMFKINQFNLMASEMIALNRSLPDVRLEGCKTKVYSDNLPTTSV
VIVFHNEAWSTLLRTVHSVINRSPRHMIEEIVLVDDASERDFLKRPLESYVKKLKVPVHV
IRMEQRSGLIKARLKGAAVSKGQVITFLDAHCECTAGWLEPLLARIKHDXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTPTMAGGLFSIDR
DYFQEIGTYDAGMDIWGGENLEISFRIWQCGGTLEIVTCSHVGHVFRKATPYTFPGGTGQ
IINKNNRRLAEVWMDEFKNFFYIISPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXIRNVETNQCLDNMARKENEKVGIFNCHGMGGNQVFSYTANKEIRTDD
LCLDVSKLNGPVTMLKCHHLKGNQLWEYDPVKLTLQHVNSNQCLDKATEEDSQVPSIRDC
NGSRSQQWLLRNVTLPEIF
Download sequence
Identical sequences ENSDORP00000014049 ENSDORP00000014049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]