SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014067 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014067
Domain Number 1 Region: 107-385,466-532
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.4e-47
Family FAD-linked reductases, N-terminal domain 0.00027
Further Details:      
 
Domain Number 2 Region: 370-476
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 1.05e-24
Family L-aminoacid/polyamine oxidase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014067   Gene: ENSDORG00000014950   Transcript: ENSDORT00000014949
Sequence length 593
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4316:237391:246657:-1 gene:ENSDORG00000014950 transcript:ENSDORT00000014949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IPNDDFCPWLSRKAMGTKRAPLSQLCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTILEADNRIGGRI
FTFRDRKTGWIGELGAMRMPSSHKILHELCKSLGLNLTKFTQYDENTWTEVNDIKLRNYV
VEKMPEKLGYTLSMAEKGHSPEDIYQMALNRAVKDLRSLGCRKMMQKYERLTLLEYLLGE
GNLSQAAVQLLGDVMSKDGFFYLSFAEAMRAHSCLSDRLRYNRIVGGWDLLPRALLSSLS
GPVLLNAPVMAVSQGSHEVRVHIATSRQSRSLKELTSDVVLMTTTGPALQRITFSPPLSR
KRQEALRALHYVPATKVFLSFRRPFWHSEHIEGGHSNTDRASRLIFYPPPGEGALLLASY
TWSDAAAPFAGLSLNEALHLALKDVAALHGPVVYRLWDGTGVVKRWGEDPHSQGGFVMQP
PLLWQTETNGPLYDWAVPYGRVYFAGEHTTYPHGWVETSVKSALRAAMKINNREWFGHTG
HEGGAWGRAPDAEGHGPVRSEANSSCGGSKEEEVRPVAPRFLSLPRTTHRKRP
Download sequence
Identical sequences ENSDORP00000014067 ENSDORP00000014067

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]