SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014083 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014083
Domain Number 1 Region: 55-195
Classification Level Classification E-value
Superfamily C-type lectin-like 6.3e-35
Family C-type lectin domain 0.0000215
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014083   Gene: ENSDORG00000014965   Transcript: ENSDORT00000014965
Sequence length 197
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6107:16836:22650:1 gene:ENSDORG00000014965 transcript:ENSDORT00000014965 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKSRLVVCLLVISLLLDQASSHSSRLKSRKHSKRRVKEKDGDLKSQVEKLWREVNALKE
MQALQTVCLRGTKVHRKCYLASEGLKHFHEANEDCISKGGTLVVPRNSDEINALRDYAKR
SLPGVNDFWVGINDMATEGKFLDVNGMAVSFLNWDRAQPNGGKRENCVLFSQSAQGKWSD
EICRTSKKYICEFTIPQ
Download sequence
Identical sequences ENSDORP00000014083 ENSDORP00000014083

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]