SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014128 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014128
Domain Number 1 Region: 239-399
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.02e-44
Family Reprolysin-like 0.00088
Further Details:      
 
Domain Number 2 Region: 541-595
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000942
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Domain Number 3 Region: 851-904
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000131
Family TSP-1 type 1 repeat 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014128   Gene: ENSDORG00000015009   Transcript: ENSDORT00000015010
Sequence length 904
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4148:153506:192806:-1 gene:ENSDORG00000015009 transcript:ENSDORT00000015010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDKTSRIRGVAAAAQPRRRRGEYAAAQERIQPSGLPRPLEPPRASRGLVQNVDRLYSGGG
KAGYLVYAGGRRFLLDLERDDSLGAAGWVPAGGGLSAPGRRHRGRCFYRGTVDGSPRSLA
VFDLCGGLDGFFAVKHARYTLKPLARGPWAEADAERVYGDGSTPILHVYTREGFSFETLP
PRASCETPTSPPGSHERPPVRGHPGPRAAALAPRLPNSAPAGAPGPQTWWRRRRRSISRA
RQVELLLVADASMARMYGRGLQHYLLTLASIANRLYSHASIENHIRLAVVKVVVLGDKDK
SLEVSKNAATTLKNFCKWQHQHNQLEDDHEEHHDAAILFTREDLCGHHSCDTLGMADVGT
ICSPERSCAVIEDDGLHAAFTVAHEIGHLLGLSHDDSKFXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXNCLLDLPRKQILGPEELPGQTYDATQQCNLTFGPEYS
VCPGMDVCARLWCAVVRQGQMVCLTKKLPAVEGTPCGKGRICLQGKCVDKTKKKYYSTSS
HGNWGSWGPWGQCSRSCGGGVQFAYRHCNNPAPRNSGRYCTGKRAIYRSCSVVPCPPNGK
SFRLEQCEAKNGYQSDAKGVKTFVEWVPKYAGVLPADVCKLTCRARGTGYYVVFSPKVTD
GTECRPYSNSVCVRGRCVRTGCDGIIGSKLQYDKCGVCGGDNSSCTKVIGTFNKKSNAYT
DVVRIPEGATHIKVRQFKAKDETRFTAYLALKKKNGEYLINGKYMISTSETIIDLNGTVM
NYSGWSHRDDFLHGMGYAATKEILIVQILATDPTKALDVRYSFFVPKKSTQKANSVTNHS
SNKVGATTQQLQWVTGPWLACSRTCDTGWHTRTVQCQDGSRKLAKGCLLAQRPSAFKQCL
LKKC
Download sequence
Identical sequences ENSDORP00000014128 ENSDORP00000014128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]