SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014131 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014131
Domain Number 1 Region: 3-167
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.19e-47
Family Eukaryotic proteases 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014131   Gene: ENSDORG00000015013   Transcript: ENSDORT00000015013
Sequence length 167
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_47937:6725:8486:1 gene:ENSDORG00000015013 transcript:ENSDORT00000015013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QFQYTVKMGDRSIYNEKSLVVPIHRIIIHPYFSTTSSVVNDLALLHLLHPVNFSTAIYPI
CVPEEAFRVEAGTRCWVTGWGKTREGLRSEVLQEVDQELIHYQECNRMMQKALSSQKTLV
MKGMLCGYLETMKDSCQGDSGGPMSCELNNTWLQVGIVSWGVGCARK
Download sequence
Identical sequences ENSDORP00000014131 ENSDORP00000014131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]