SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014166 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014166
Domain Number 1 Region: 40-186
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.1e-27
Family Ankyrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014166   Gene: ENSDORG00000015050   Transcript: ENSDORT00000015049
Sequence length 389
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_19503:3839:7837:-1 gene:ENSDORG00000015050 transcript:ENSDORT00000015049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASHVRRGTHPQLRLEAEELDMAETPSCPKEETPAPDESLGALYWACVHNHPAQLQAILDA
GVSPEQVAHVDSNGRTGLMVACYHGFASIVTLLSRCPYLDVNHQDKEGNTALMLAAQAGH
TPLVSFLLNYYAGLDLERRDQRGFTALMKAAVQDRRADLTSVDPVRGKTSLEWAVLTDSF
NTVRRIRQLLRRPRAEQLSQHYQPEWPPLPGLVAQAQAQAQAAPSLLERLQASLNSSFAQ
PPQEGGVLDHLVTITTGLASPFLTTACHTLCPDQPPALGTRSKSVPELLGTAPPPAPAPQ
PSASPSRAFVPYQSTQGLLSQWLQPRDSTNKKFQVPKILLSKAHSSPSQCPSIPRSVGHQ
SLALPLWPYQELRMARKRQEEEARCTQNQ
Download sequence
Identical sequences ENSDORP00000014166 ENSDORP00000014166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]