SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014173 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014173
Domain Number 1 Region: 3948-4144
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.98e-32
Family Laminin G-like module 0.0065
Further Details:      
 
Domain Number 2 Region: 230-350
Classification Level Classification E-value
Superfamily Cadherin-like 4.28e-31
Family Cadherin 0.00063
Further Details:      
 
Domain Number 3 Region: 873-990
Classification Level Classification E-value
Superfamily Cadherin-like 3.14e-30
Family Cadherin 0.00071
Further Details:      
 
Domain Number 4 Region: 2654-2764
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-29
Family Cadherin 0.0004
Further Details:      
 
Domain Number 5 Region: 455-577
Classification Level Classification E-value
Superfamily Cadherin-like 4.71e-29
Family Cadherin 0.00074
Further Details:      
 
Domain Number 6 Region: 1301-1404
Classification Level Classification E-value
Superfamily Cadherin-like 7.85e-29
Family Cadherin 0.0011
Further Details:      
 
Domain Number 7 Region: 674-777
Classification Level Classification E-value
Superfamily Cadherin-like 4.43e-28
Family Cadherin 0.00075
Further Details:      
 
Domain Number 8 Region: 1196-1307
Classification Level Classification E-value
Superfamily Cadherin-like 6.71e-28
Family Cadherin 0.00037
Further Details:      
 
Domain Number 9 Region: 1400-1531
Classification Level Classification E-value
Superfamily Cadherin-like 6.14e-27
Family Cadherin 0.00087
Further Details:      
 
Domain Number 10 Region: 2851-2981
Classification Level Classification E-value
Superfamily Cadherin-like 2e-26
Family Cadherin 0.0017
Further Details:      
 
Domain Number 11 Region: 3173-3283
Classification Level Classification E-value
Superfamily Cadherin-like 4.57e-26
Family Cadherin 0.00076
Further Details:      
 
Domain Number 12 Region: 981-1084
Classification Level Classification E-value
Superfamily Cadherin-like 5.42e-26
Family Cadherin 0.0011
Further Details:      
 
Domain Number 13 Region: 3074-3185
Classification Level Classification E-value
Superfamily Cadherin-like 1.71e-25
Family Cadherin 0.0011
Further Details:      
 
Domain Number 14 Region: 2344-2447
Classification Level Classification E-value
Superfamily Cadherin-like 1.14e-24
Family Cadherin 0.00059
Further Details:      
 
Domain Number 15 Region: 567-673
Classification Level Classification E-value
Superfamily Cadherin-like 1.57e-24
Family Cadherin 0.0011
Further Details:      
 
Domain Number 16 Region: 4233-4391
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.83e-23
Family Laminin G-like module 0.0016
Further Details:      
 
Domain Number 17 Region: 780-885
Classification Level Classification E-value
Superfamily Cadherin-like 1.43e-22
Family Cadherin 0.0012
Further Details:      
 
Domain Number 18 Region: 2758-2856
Classification Level Classification E-value
Superfamily Cadherin-like 2e-22
Family Cadherin 0.00089
Further Details:      
 
Domain Number 19 Region: 2446-2560
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-21
Family Cadherin 0.0031
Further Details:      
 
Domain Number 20 Region: 2962-3076
Classification Level Classification E-value
Superfamily Cadherin-like 6.42e-21
Family Cadherin 0.0011
Further Details:      
 
Domain Number 21 Region: 1852-1936
Classification Level Classification E-value
Superfamily Cadherin-like 2.66e-20
Family Cadherin 0.0022
Further Details:      
 
Domain Number 22 Region: 1080-1193
Classification Level Classification E-value
Superfamily Cadherin-like 3.71e-20
Family Cadherin 0.0028
Further Details:      
 
Domain Number 23 Region: 3495-3598
Classification Level Classification E-value
Superfamily Cadherin-like 1.01e-19
Family Cadherin 0.00072
Further Details:      
 
Domain Number 24 Region: 2556-2660
Classification Level Classification E-value
Superfamily Cadherin-like 8.85e-19
Family Cadherin 0.0041
Further Details:      
 
Domain Number 25 Region: 338-459
Classification Level Classification E-value
Superfamily Cadherin-like 7.14e-16
Family Cadherin 0.0014
Further Details:      
 
Domain Number 26 Region: 1509-1615
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000002
Family Cadherin 0.0019
Further Details:      
 
Domain Number 27 Region: 3841-3967
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000126
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 28 Region: 3449-3502
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000557
Family Cadherin 0.0047
Further Details:      
 
Domain Number 29 Region: 1619-1724
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000003
Family Cadherin 0.0018
Further Details:      
 
Domain Number 30 Region: 47-124
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000728
Family Cadherin 0.0048
Further Details:      
 
Domain Number 31 Region: 4418-4456
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000018
Family EGF-type module 0.013
Further Details:      
 
Domain Number 32 Region: 1720-1762
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000485
Family Cadherin 0.0051
Further Details:      
 
Domain Number 33 Region: 186-242
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000107
Family Cadherin 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014173
Domain Number - Region: 3796-3853
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0291
Family EGF-type module 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014173   Gene: ENSDORG00000015055   Transcript: ENSDORT00000015056
Sequence length 4721
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6293:14076:145541:1 gene:ENSDORG00000015055 transcript:ENSDORT00000015056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLAADGAAGHACPPPLTLCPSQLLRVLWLLCLLPGPAWVQGAEQRQVFQVLEEQPPGTL
VGAIQTRPGFTYRLSESHALFAINSSTGVLYTTATIDRESLPSDVINLVVLSSSPTYPTV
RVLVPDSEYAVFPEPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXVTLNPSDELLLVSKGRLREVIQQYQLLVEVEDKEPKRRGYLQVNVTVQDINDNPP
VFDSTQYQAGVPEDAAVGSSVLQVAAADADEGTNADIRYRLQDEGTPFQMDPETGLITVR
EPLDFEARRQYALTVQAMDRGVPSLTGRAEALIRLLDVNDNDPVVKFRYFPATSRYASVD
ENAQVGTVVALLTVTDADSPAANGNISVQILGGNEQRHFEVQRSKVPNLSLIKVASALDR
ERIPSYNLTVSVSDNFGVPPTAETRARSSVASLVIFVNDINDHPPVFAQQVYRVNLSEEA
PPGSYVSGVSATDGDSGLNANLRYSIVSGNELGWFRISEHSGLVTTAASGGLDRELESQI
VLNISARDQGVHPRVSYAQLVVTLLDVNDQKPVFSQPQGYQVSVVENTPTGTELLVVGAE
DGDLGDNGTVRFSLQEPEGAHRAFRLDPLSGRLSTVSFLDREEQASYSLWVMATDLGSPP
QTSVARINVSLVDLNDNTPVFYPVQYFAHIQENEPGGSYVTTVSASDPDLGPNGTVRYTI
SAGDRSRFQINAQSGVISTRMALDREEKTAYQLQVVATDGGNLQSPNQAIVTITVLDTQD
NPPVFSQAAYSFVVFENVALGYQVGRVSATSMDLNTNITYVITTGDQKGMFAIHQATGQL
TTASVIDREDQAFYQLKVVASGGAVTGDTEVNITVKDLNDNAPHFLQAVESVNVVENWQA
GHTVFQAKAEDPDEGVNGLVVYSLKQNPMNLFAIDERNGTVSLLGSLDAHAGSYQMEILA
CDTGVPQLSSSLIVTVYVHDVNDNPPVFDQISYEVTLSESEPVNSRFFQVQASDQDSGAN
GEIAYDIVEGNTAGVFGIFPDGQLYIKSELDRELQDRYILMVVASDRAIEPLSATVNVTV
ILEDVNDNRPLFNSTNYMFYFEEEQAAGSFVGKVSAADKDLGPNGEVRYSFEMSQPDFEL
HAITGEITSTRQFDRESFVRQRGNAMFSFTVIAMDQGLPHVLKDQASVHVYMKDINDNAP
KFLKDFYQATISETAANLTQVLRVSASDVDEGNNGLIHYYLIKGNEERHFAVDSISGQVT
LIGTLDYETTPAYSLVIQAVDSGAISLNSTCTLTIEILDENDNNPSFPKATLMVDVLENM
RVGELVSSVTATDSDSGDNADLHYSITGTNNHGTFSISPNTGSIFLAKKLDFETQSLYKL
NITAKDHGRPPRSSTMSVVIQVRDSNDNAPSFPPGDIFKSIEENIPVGSPVLSVTAHDPD
ADINGRLAYAIVQQRPRGGHFCIDEAQGVIYTSAEIDREFANLFELTVRASDQAMPVETR
RCALKNVTILVTDLNDNVPTFISQNALAVDPATVAGSVLTTLLAADPDEGVNGEVEYEIV
NGDAGAFSVDRFSGDLRVAAALVPSRLVYNLIVAATDLGPERRRSTTELTVLLQGLDGPA
FTQPKYITILKEGEPIGTNVISVEAASPRGAEAPVEYYIVSVRCEEKTVGRLFTIGRHTG
VLQTAAVLDREQGACLYLVDVYAIEKSSAFPRTQRAEVEITLQDINDNPPVFPADTLDLT
VEENVGDGARILQLSAMDADEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLVAAILATDD
DSGVNGEITYIVNEDDEDGIFFLNPVTGVFNLTRVLDYEAQQYYILSVRAEDGGGQFATV
RVYFNILDVNDNPPVFSLSSYSTSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPALTGTG
TINVIIDDINDNVPTFASKMYFTEISEDAPTGTDVLLVNASDADASTNAVISIMGGDAQF
TINPSTGQIITSALLDRETKDNYTLVVVASDAGSPESLSSSTSVLVTVADVNDNPPRFQH
HPYVTHIPSPAPPGFVFAVTVTDADVGPNSKLHYSLSGGHSEKFHIDPLRGAITTAGPLS
GVSEMTFSVHVRDGGSLPRADSTTVTIRFANKADFPKVRAKEQALVFPENQPVGTLATTV
TGSSPRGDALSYYIASGNLGGAFQIDPLTGQVSIRRPLDFERTQRYVVWIEARDAGFPPF
SSYEKLDITVLDVNDNAPIFREDPFAAAVLENLSPRTVLTVSAVDRDSGPNSQLGYEIVD
GNAENSFSIHHATGEIRSTRPLDREKTPRYVLTVRSSDKGSPSRSTSVRVVITVLDENDN
APKFSQIFTAHVSENSPLGFTVTRVTTSDEDIGVNAVSRYSLTDQSLPFSINPSTGDIVV
SRPLDREDTDRYRIRVSAHDSGWTVSTDVAIFVTDVNDNAPRFGRPSYYLDCPELMDVGA
GVARVSAADPDEGANGQVVYFIKSQSEYFRINATTGEIFNKQALKYQNISGIGNVNVNRH
SFVVTASDRGAPALLSETTVTIRIVDSNDNAPRFPQDRYFTPVTKTARVGARLIQVTAVD
DKDFGLNSQVEYFMSDHSRLGRFTMDRDTGWISVASSLISDLNQDFLITVTAKDKGNPPL
SSQATVQITVTEENYHTPEFSQSHVTVTVPESYGVGGVIRTLSARDGDAAMNGAIQYGIS
SGNEEGTFAINSSTGVLTLAKALDYELCRKHELTVSAADGGWVVRTGFCRVTVHVADVND
NSPAFVPEEYFLTVLENAPSGTTVVHLNATDADSGMNAVVAYSVQASDSDLFIIDPNTGI
LTTQGFLDFETKQSYHLTVKAFNVPDEDRCGFASITIQLEGTNVXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXQTGQITVTAELDREARPVYNLTVLAVDSGTP
PATGSAAVLVTLEDINDNGPLLAISEGEVTENQRPGTLVLTLRSTDPDLPPNQGPFTYHL
LSTGPATNYFSLSSAGVLSTTREIDREQIATFRLSVVTRDSGIPQMSSTGTVRITVRDQN
DNPSQPRALDIFVHYFGKVFPGGILGSVKPQDPDVLDSFRCTLTSGLTGLFSIPAGACEL
SAQPRSSDGAFDLTVLSSDGLHSAVTSSVRVLFSGFSNATVDNSILLRVAVPTVRDFLTN
HYVPFLRTAGSQLTGLGTAVQLYGAYEENNRTFLLAAVKRNSNQYVSASGVATFFESIQE
VLLRQSGVRIESVDHDACAQGPCQNGGSCIRRLAVSPDLQSRESLPVILVANEPLQPFFC
RCLPGYAGNWCETDIDECLPAPCHNGGTCHNLVGGFSCSCPEGFTGRACERDINECLPSP
CKNGAICQNFPGGFNCVCKTGYTGKMCESSVNYCECNPCFNGGSCQSGMDTYYCHCPFGV
FGKHCELNSYGFEELSYMEFSLDPNNNYIYVKFATIKSHALLLYNYDNQTGERAEFLALE
IAEERLRFSYNLGSGTYKLTTMKKVSDGHFHTVIARRAGMAASLTVDSCSENQEPGYCTV
SNVAVSDDWLNVQPNRVTVGGLRSLEPILQRPGHVESHDFVGCIMEFAVNGRPLEPSQAL
AVHGLLDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKYCEKSITPDTALSLE
GKGRLDYHMSQNEKREHLLRQSLRGAPVEPYGVNSLEVKFRTRSENGILIHIQESSNYTT
VKIKNGKVHFTSDAGIAGKVERNIPEVYVADGHWHTFLIGKNGSATVLSIDRMYSRDILH
PTQDFGGLDVLTISLGGIPPNQAHRDAQTAGLSGCIAWVLYGGESLPFSGKHSLASISKT
DPSVKIGCRGPNICASNPCWGDLLCLNQWYAYKCVPPGDCASHPCQNGGSCEPGLVSDFT
CSCPESHTGRTCETVVACLGILCPQGKVCKAGSHGGHVCVLSPSPEEISLPLWAVPAIVG
SCATVLAFLVLSLIVCNQCRGKKGKSPKQDKKPKEKKKKKKKKKGSENVAFDDPDNIPSY
ADDLTVRKQPEGNPKPDIIERENPYLIYDETGLPHGAETVPSAPLASPEQEIEHYDIDNA
SSIAPSDADIIQHYKQFRSHTPKFSIQRHSPLGFARQSPMPLGASSLTYQPSYGPGLRSG
SLSHSACPTPNPLSRHSPAPFSKSSTFYSNSPARELHLPLR
Download sequence
Identical sequences ENSDORP00000014173 ENSDORP00000014173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]