SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014202 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014202
Domain Number 1 Region: 3-99
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.46e-23
Family Eukaryotic proteases 0.00021
Further Details:      
 
Domain Number 2 Region: 181-227
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000000173
Family Eukaryotic proteases 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014202   Gene: ENSDORG00000015085   Transcript: ENSDORT00000015086
Sequence length 228
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_941:11066:14495:-1 gene:ENSDORG00000015085 transcript:ENSDORT00000015086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHLSLPLLLFLLCSGAKAEEIIGGTECKPHSRPYMAYLDIVHSQGKFCGGFLIRRDFVL
TAAHCAGRFMTVTLGAHNTTERDTWQIVEKQFPHPKYXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXGDSGGPILCAGIAGIASYVHINVSPPAVFTRISYYRDWINKILREN
Download sequence
Identical sequences ENSDORP00000014202 ENSDORP00000014202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]