SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014204 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014204
Domain Number 1 Region: 102-420
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 4.5e-58
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000444
Further Details:      
 
Domain Number 2 Region: 510-551
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000944
Family Ricin B-like 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014204   Gene: ENSDORG00000015088   Transcript: ENSDORT00000015089
Sequence length 554
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_724:39811:81128:1 gene:ENSDORG00000015088 transcript:ENSDORT00000015089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKIRANAIAILTVAWILGTFYYLWQDNRAHAASSGGRSAQRAGGRPEPFREDRTIPLIV
TGTPSKGFDEKAYLSAKQLKPGEDPYRQHAFNQLESDKLSPDRPIRDTRHYXCPSVSYSL
DLPATSVIITFHNEARSTLLRTVKSVLNRTPANLIHEIILVDDFSSDPEDLLLIRIPKVK
LRNDRREGLIRSRVRGADVAAAAVLTFLDSHCEVNTEWLQPMLQRVKEDHTRVVSPIIDV
ISLDNFAYLAASADLRGGFDWSLHFKWEQIPLEQKMTRTDPTKPIRTPVIAGGIFVIDKS
WFNHLGKYDAQMDIWGGENFELSFRVWMCGGSLEIVPCSRVGHVFRKRHPYNFPEGNALT
YIRNTKRTAEVWMDEYKQYYYEARPSAIGKAFGSVASRIEQRKKMDCKSFRWYLENVYPE
LTVPVKEVLPGIIKGVNCLESQGQDTSDFLLGMECKRSALIPPAHYLXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKWRRKGSFIQHSVSGLCLETKPAQLVTSKCQ
ADAQAQQWQLLPHT
Download sequence
Identical sequences ENSDORP00000014204 ENSDORP00000014204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]