SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014212 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014212
Domain Number 1 Region: 21-181
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.97e-45
Family Dual specificity phosphatase-like 0.0000000855
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014212   Gene: ENSDORG00000015098   Transcript: ENSDORT00000015098
Sequence length 185
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4429:34641:44824:-1 gene:ENSDORG00000015098 transcript:ENSDORT00000015098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGPFDLSVQDLNDLLSDGTGCYSLPSQPCNEVTPRIYVGNATVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAHKNGRV
LVHCREGYSRSPTLVIAYLMMRQKMDVRSAVSIVRQNREIGPNDGFLAQLCHLNGRLIRE
GKLKL
Download sequence
Identical sequences A0A1S3GHE1
ENSDORP00000014212 ENSDORP00000014212 XP_012887427.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]