SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014215 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014215
Domain Number 1 Region: 108-267
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.81e-54
Family Matrix metalloproteases, catalytic domain 0.00000742
Further Details:      
 
Domain Number 2 Region: 287-360
Classification Level Classification E-value
Superfamily Hemopexin-like domain 7.72e-19
Family Hemopexin-like domain 0.0007
Further Details:      
 
Domain Number 3 Region: 26-104
Classification Level Classification E-value
Superfamily PGBD-like 1.11e-18
Family MMP N-terminal domain 0.00049
Further Details:      
 
Domain Number 4 Region: 410-480
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.19e-16
Family Hemopexin-like domain 0.00049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014215   Gene: ENSDORG00000015101   Transcript: ENSDORT00000015101
Sequence length 480
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3141:14888:50191:-1 gene:ENSDORG00000015101 transcript:ENSDORT00000015101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLPASGLAVLLVTALKSTAFPSLFVATPRTWRNNYHLAQAYLQKYYTSKGNLQMGEMV
ARGGSPLVKKVKELQAFLGLQVTGKLDRNTMDMIKKPRCGVPDVANYRLFPGEPKWKKNT
LTYRISKYTPSMRPAEVDKAVEMALRAWSSAVPLNFVRINSGEADIMISFETGDHGDSYP
FDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPS
ALMYPTYKYQQPYGFRLPKDDVKAIALYGLRKPFLGKTAPHIPPHKPSIPDLCDSSSSFD
AVTMLGKELLFFKDRIFWRRQVHLPSGIRPSTITSSFPQLMSNVDAAYEVAERGLAFFFK
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYSYDERKRK
MEKDYPKSTEEEFSGVNGQIDAAVELNGYIYFFSGPKTFKYDTEKEDVVSVLKSSSWVGC
Download sequence
Identical sequences ENSDORP00000014215 ENSDORP00000014215

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]