SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014216 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014216
Domain Number 1 Region: 274-466
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.66e-62
Family Hemopexin-like domain 0.00000163
Further Details:      
 
Domain Number 2 Region: 101-262
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.58e-53
Family Matrix metalloproteases, catalytic domain 0.00000531
Further Details:      
 
Domain Number 3 Region: 32-96
Classification Level Classification E-value
Superfamily PGBD-like 1.46e-19
Family MMP N-terminal domain 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014216   Gene: ENSDORG00000015102   Transcript: ENSDORT00000015102
Sequence length 513
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3141:68912:78525:-1 gene:ENSDORG00000015102 transcript:ENSDORT00000015102 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKSHWPLFLLLITFSSAFPADLEVENEGDKQLAQAYLNQFYSLEIEGSHLIQSKNRSLLD
GKIREMQAFFGLTVTGKLDSNTLEIMKAPRCGVPDVGQYGYTLPGWQKHHLTYRIMNYTP
DMARADVDEAIHKALAVWSKVTPLTFTKVSRGIADIMVAFRTRVHGWCPRYFDGPLGVLG
HAFPPGLGLGGDTHFDEDEKWTTTDEAGFNLFLVAAHEFGHSLGLSHSNDQTALMFPNYV
SLDPNRYPLSQDDINGIQSIYGGLPQATSKPRAPTIPHACDPDLTFDAITTLRREVMFFK
GRHLWRIYYDIADVEFEPIASFWPFLPADLQAAYENPNDKILVFKDENFWMISEYAVLPD
YPKSIYSLGFPRHVKKIDAAVCDQNTKKTYFFVGIWCWRYDEMTQRMERGYPQRVVRHFP
GISLRVDAAFQHKEFFYFFRGSKQFEYDIKSRNITRVMRTNSWFKCKEPLNSSFDFGIEE
KAHSGGIRILCHKKLSFLIFSIVHLLKQIYSSQ
Download sequence
Identical sequences A0A1S3EKR7
XP_012864983.1.60039 ENSDORP00000014216 ENSDORP00000014216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]