SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014217 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014217
Domain Number 1 Region: 275-466
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.53e-63
Family Hemopexin-like domain 0.000000531
Further Details:      
 
Domain Number 2 Region: 103-266
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.11e-55
Family Matrix metalloproteases, catalytic domain 0.000000392
Further Details:      
 
Domain Number 3 Region: 35-98
Classification Level Classification E-value
Superfamily PGBD-like 2.67e-19
Family MMP N-terminal domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014217   Gene: ENSDORG00000015105   Transcript: ENSDORT00000015103
Sequence length 468
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3141:80868:89266:-1 gene:ENSDORG00000015105 transcript:ENSDORT00000015103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IFNLKTLTLVFFLYMQLSKAFPVPSEHLVERNAKTVQNYLEKFYQLPSLQYQSARKNSTS
MIAEKLKEMQRFFGLNVTGKPNKETLEMMEKPRCGVPDSGDFMLTPGKPKWKRTDLTYRI
LNTVQLSKAQVERAVEDAFRVWSKASPLTFTRVLQGEADIMIAFARRDHGDNSPFDGPNG
ILAHAFQPGPGIGGDAHFDADETWTQSSTNYNLFLVAAHEFGHSLGLSHSSDPGALMYPN
YAFREPSTYSLPQDDINGIQAIYGPSHDPIQPTGPSTPRACDPRLTFSAATTLRGEILFF
TDKYFWRRHPQLRQVELNFISLFWPALPSGIQAAYEDLDRDLVFLFKGRQYWALSGYDIQ
QGYPRDISNYGFPHTIQAIDAAVSYAGKTYFFVNDQFWRYDNQRQSMEPGYPQEVSRVFP
GLESRIDAVFLQDYFFLFFSGPRYYAFNLLARRVTRVARSNLWLNCRG
Download sequence
Identical sequences ENSDORP00000014217 ENSDORP00000014217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]