SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014222 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014222
Domain Number 1 Region: 287-478
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-66
Family Hemopexin-like domain 0.000000547
Further Details:      
 
Domain Number 2 Region: 102-267
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.26e-56
Family Matrix metalloproteases, catalytic domain 0.000000232
Further Details:      
 
Domain Number 3 Region: 34-98
Classification Level Classification E-value
Superfamily PGBD-like 1e-19
Family MMP N-terminal domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014222   Gene: ENSDORG00000015107   Transcript: ENSDORT00000015108
Sequence length 478
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3141:91828:100245:-1 gene:ENSDORG00000015107 transcript:ENSDORT00000015108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNLAILMLLGLPLCTAHPLHGAVKEEEQKTMELAQHYLESYYNFGKEEKQIFRRKDSSP
VVKKIQEMQKFLGLEVTGKLDSDTMRMMGRPRCGVPDVGHFTTFPDTPKWQKNHLTYRIV
NYTPDLPRQVVDSAIEKALRVWAEVTPLTFFRMYAGEADIMISFAVREHGDFYPFDGPGN
SLAHAYPPGPGFYGDVHFDEDEKWTENASGTNLFLVAAHELGHSLGLFHSANREALMFPV
YQSFKDLAQFHLSQDDIAGIQSLYGPPPPPPRQPLVPTEYMPPRHRTPAKCDPALSFDAV
STLRGELLFFKDRFFWRRPRWSLQPQRHLISAFWPSLPSELDAAYEVISKDTVFIFKGNK
FWAVRGTDIQADYPKDIHTLGFPPTIKKIDAAVSDKEKEKTYFFVKDEYWRFDEKSQSME
RGFPRRIADGFPGVGPKVDAVLQAFGFFYFFNGSSQFEFDANARRVTHILKSNSWLLC
Download sequence
Identical sequences ENSDORP00000014222 ENSDORP00000014222

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]