SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014226 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014226
Domain Number 1 Region: 101-264
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.82e-56
Family Matrix metalloproteases, catalytic domain 0.000000211
Further Details:      
 
Domain Number 2 Region: 272-465
Classification Level Classification E-value
Superfamily Hemopexin-like domain 1.05e-48
Family Hemopexin-like domain 0.000000101
Further Details:      
 
Domain Number 3 Region: 19-96
Classification Level Classification E-value
Superfamily PGBD-like 2.2e-20
Family MMP N-terminal domain 0.0000805
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014226   Gene: ENSDORG00000015112   Transcript: ENSDORT00000015112
Sequence length 468
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_3141:105473:113180:-1 gene:ENSDORG00000015112 transcript:ENSDORT00000015112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHFSLLLLLLCGVGSHSFPVAPETQQQDVETVQKYLEKYYDLKDVGTHIERRRNSGSVV
EKLKQMQEFFGLRVTGKPDAETMKVMKQPRCGVPDVARFVLTQGNPHWEKTDLTYRIENY
TPDLSEAEVDHAIEKAFQLWSNVTPLTFTKLPAGQADIMISFVRGDHHDNSPFDGSGGNL
AHAFQPGPGIGGDAHFDEDERWTNNYRDYNLYRVAAHELGHSLGLSHSTDIGALMYPNYI
FSGDVQLAQDDINGIQTIYGPSKNPTQPTGSQTPEVCDSKLTFDAITTIRGELMFFKDRF
YMRANSVYPEVELNFISVFWPSLPSGIEAAYELAERDEIRFFKGSKYWAVLGQDVLRGYP
KDIHSSFGFPRTVKHIDAAVSEEDTGKTYFFVANKYWXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXFFYIFHGTRQYKFDAKTKRILSLQKANSWFNCRKK
Download sequence
Identical sequences ENSDORP00000014226 ENSDORP00000014226

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]