SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014271 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014271
Domain Number 1 Region: 28-140
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.71e-33
Family Single strand DNA-binding domain, SSB 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014271   Gene: ENSDORG00000015161   Transcript: ENSDORT00000015160
Sequence length 148
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_6719:39054:47348:1 gene:ENSDORG00000015161 transcript:ENSDORT00000015160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFRRPVLQVLRQFVRHESEIATSLVLERSLNRVQLLGRVGQDPVLRQVEGKNPVTIFSLA
TNEMWRSGESEAYQMGDVNQKTTWHRISVFRPGLRDVAYQYVKKGSRIYVEGKVDYGEYM
DKNNVRRQATTIIADNIIFLSDQTREKS
Download sequence
Identical sequences A0A1S3FLU3
ENSDORP00000014271 ENSDORP00000014271 XP_012876992.1.60039 XP_012876994.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]