SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014319 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014319
Domain Number 1 Region: 961-1106
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 2.39e-33
Family Crystallins/Ca-binding development proteins 0.00026
Further Details:      
 
Domain Number 2 Region: 1242-1325
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 2.53e-22
Family Crystallins/Ca-binding development proteins 0.00066
Further Details:      
 
Domain Number 3 Region: 908-985
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.000000000000524
Family Crystallins/Ca-binding development proteins 0.0031
Further Details:      
 
Domain Number 4 Region: 1328-1434
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000024
Family Ricin B-like 0.022
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014319
Domain Number - Region: 1156-1196
Classification Level Classification E-value
Superfamily gamma-Crystallin-like 0.00509
Family Crystallins/Ca-binding development proteins 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014319   Gene: ENSDORG00000015211   Transcript: ENSDORT00000015212
Sequence length 1434
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_1801:26578:66235:1 gene:ENSDORG00000015211 transcript:ENSDORT00000015212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PARPKSVELSLKTPKNSDSSGNEHNSFSQPVHKGNTATKISLFENKRMNSTPKHSDVRST
RSIPPSNKTFVGRAKLNLAKKAKEMEQLEKKTVPNSQQNGVLAKDPPAETRAPVLPVAGG
AGQELPEGQALTPQPNQGDKADVQTNAGWVSEPEAPTITDPMPSGEDDSEAAGSKRLELN
TAQDGSAIVDAKDSPPKPQDVFCDSQPPAESCQGPSLPLVDSPQNGCAQVPISHLCPDLQ
ESESHNGCTLPSSPYIEKVPLSAGTGGEDNHPLSPKHSLEAVGPEAPSKVLVQVRSFVLP
AESTQDVSSQIISESXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQSETLRPDENVVNGQDSA
SHLNVSATSDDSVFDSSDMEKFTEIIKKMDSVVCVPQKKKKTRMPNSRAPHFAMPPIHED
NLEKVLDPNVFTFGLGKKKESLPEPPPSLHLMDNLDPKSKLRPKRASADQSILFKSLHPN
AGGKSESQATPEVSDKGSRDVSNGGVKRSRLEKSTLFSSMLSSLPQDKVFSPSVTSVNTM
TTSFSTSQNPSLSCSSGAQPRMEGAPPCASDKEQPHLAPHNSIQVFNFTSSSPSCSGLKS
SSHMEKYPPKEEHKEELNSRSNLHLPEMKFSEVSKLRNHEGIEKANHVESVLKPHLPNHG
NSDTDFIGLFKPSRYDPAISFSGMSLSDPATLRGSLQSKLNPRPGXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXWLIYEEPGFQGVPFILEPGEYPDLAFWDTEEAYIGSMRPLKMGGRKVEFPTD
PKVVIYEKPLFEGKCMELETEMCSFITEEGEAEKTTGNGHLPFTSVGSMKVLRGIWVAYE
KPGFTGHQYLLEEGEYKDWKDWGGYNGELQSLRPILGDFSNAHMIMYSEKNFGSKGSSID
VLGIVANLKDTGYGVKTQSIHVLSGVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXDSAGPRRRNQVHLFSEPQFQGQSQSFEETTSQIDDSFSTKSCRILGGXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEFSEPAIILFERENFKGKKIE
LNAETVNLQSLGFNTQIRSVQVIGGIWITYEFGNYRGRQFLLSPAEVPNWYEFSGCRQIG
SLRPFAQKRIYFRLRNKATGLFMSTNGNLDDLKLLRIQVMEDVGADDQIWIYQEGCIKCR
IAEDCCLTIVGSLVTSGSKLGLALDQNVDCQFWCMKSDGRIYSKLKPNLVLDIK
Download sequence
Identical sequences ENSDORP00000014319 ENSDORP00000014319

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]