SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014321 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014321
Domain Number 1 Region: 159-213
Classification Level Classification E-value
Superfamily C-type lectin-like 6.47e-17
Family C-type lectin domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014321   Gene: ENSDORG00000015214   Transcript: ENSDORT00000015214
Sequence length 222
Comment pep:novel genescaffold:dipOrd1:GeneScaffold_2359:52387:60443:1 gene:ENSDORG00000015214 transcript:ENSDORT00000015214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFVNFSLGVLAPPRPPRAGKSPENPPLPPKALAVTALDLPSVSCPSRQSGGDLEPSPFQP
SLTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXTGMAGLAGLKKDLDGVRADTSQALLELRGLVDCGRVTCPDGWLPFEDKC
YFFSSTTASWDEARNFCQESYSHLVIVNSFAEHFLGPPGTQQ
Download sequence
Identical sequences ENSDORP00000014321 ENSDORP00000014321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]