SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014359 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014359
Domain Number 1 Region: 77-271
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 3.41e-57
Family Nuclear receptor ligand-binding domain 0.0000328
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014359   Gene: ENSDORG00000015255   Transcript: ENSDORT00000015255
Sequence length 272
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_201:17:3208:1 gene:ENSDORG00000015255 transcript:ENSDORT00000015255 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQNERQPRSLAQALDGADARPAPLAASPPLAGPGPRGALGQRFLAGLVAAETCAKLEPED
AEENIDVTSNDPELRSSPCGLDGIHEASARLLFMAVKWAKSLPVFSHLPFRDQVILLEEA
WSELFLLGAIQWSLPLDSCPLLAPPEAPGAGGSQSRVALASAEMRFLQETIARFRALAVP
EFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKACHPSQPVRFGKLLLLLPSL
RFITSERIELLFFRKTIGNTPMEKLLCDMFKN
Download sequence
Identical sequences ENSDORP00000014359 ENSDORP00000014359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]