SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014368 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014368
Domain Number 1 Region: 5-136
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.48e-30
Family APC10-like 0.00000086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014368   Gene: ENSDORG00000015267   Transcript: ENSDORT00000015265
Sequence length 143
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_372:52557:65681:-1 gene:ENSDORG00000015267 transcript:ENSDORT00000015265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKVDLCLNSEGSEVILATSSDDKHPPENIIDGNPETFWTTTGMFPQEFIICFHKHVKIE
KLIIQSYLVQTLKIEKTTAKEPTGFELWIQKDLVHTEGQLQNEEIVARDGYATYLRFIIL
SAFDHFASVHSICAEGIAVSTLS
Download sequence
Identical sequences A0A1S3FMA6
ENSDORP00000014368 ENSDORP00000014368 XP_012877692.1.60039 XP_012877693.1.60039 XP_012877694.1.60039 XP_012877695.1.60039 XP_012877696.1.60039 XP_012877697.1.60039

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]