SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014409 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014409
Domain Number 1 Region: 214-391
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.3e-16
Family Laminin G-like module 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014409   Gene: ENSDORG00000015308   Transcript: ENSDORT00000015308
Sequence length 399
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_2593:5043:9650:1 gene:ENSDORG00000015308 transcript:ENSDORT00000015308 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENRSPLAILHLLLLLLLPCTHQEQALGFVLPTQXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXTLVSAPSSLTNCDVELQPGLFFPPGTHAEFRLQDIPQP
HEDPWMFSLDLGFKMAAGSGHLLALAAPENSSWLSLQLQDQKVVLSSWAGPGLSLPLVLG
IPLQLKLNVSRVVLSQGWKSEVLSLPPLELGPFPNLWAQPQGRLFMGALPGENSSASFCL
DGLWAQGQRLDIDKALSRSQDIWTHSCPQSPGNGSDTSH
Download sequence
Identical sequences ENSDORP00000014409 ENSDORP00000014409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]