SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014410 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014410
Domain Number 1 Region: 66-202
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 6.67e-41
Family Dual specificity phosphatase-like 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014410   Gene: ENSDORG00000015309   Transcript: ENSDORT00000015309
Sequence length 217
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_4579:4465:19562:1 gene:ENSDORG00000015309 transcript:ENSDORT00000015309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARMQVVEEVEPSGGGGCGYVQDH
SLDLQVGVVKPWLLLGSQDAAHDLDTLRKYKVTHILNVAYGIENAFLSEFTYKNISILDL
PETNILSYFPECFEFIEQAKMKDGVVLVHCNAGVSRAATIVIGFLMYSEEISFPGAFSFV
KNARPSICPNSGFMEQLQTYQEGKASSLCARIKSNSS
Download sequence
Identical sequences ENSDORP00000014410 ENSDORP00000014410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]