SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014411 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014411
Domain Number 1 Region: 4-93
Classification Level Classification E-value
Superfamily UDP-Glycosyltransferase/glycogen phosphorylase 8.52e-25
Family Gtf glycosyltransferase 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014411   Gene: ENSDORG00000015313   Transcript: ENSDORT00000015310
Sequence length 93
Comment pep:novel scaffold:dipOrd1:scaffold_837:16898:20044:1 gene:ENSDORG00000015313 transcript:ENSDORT00000015310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RPTTILELMAKADIWLIRTYWDLDFPRPLLPNFEFVGGLHCKPAKPLPEEMEKFVQSSGD
QGVVVFSLGSMVSNLTEERANTIASALAQIPQK
Download sequence
Identical sequences ENSDORP00000014411 ENSDORP00000014411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]