SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014434 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014434
Domain Number 1 Region: 124-184
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000342
Family Ankyrin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014434   Gene: ENSDORG00000015336   Transcript: ENSDORT00000015336
Sequence length 319
Comment pep:known_by_projection genescaffold:dipOrd1:GeneScaffold_3854:41290:49399:-1 gene:ENSDORG00000015336 transcript:ENSDORT00000015336 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMMLKVEELVTGKKNSNGEAGEFLPEDFRDGEYEAAVTLEKQEDLKTLPTHHVSLGEQQW
KNEKQREAELKKKKLEQRSKLENLEDLELIIQLKKKKKYRKAKVPVVKEPEPEIITEPVD
VPRFLKAALENKVPVVEKFLSDKNNPDVCDEYKRTALHRACLEGHLAIVEKLIQAGAQIE
FRDMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGKTPMDLVLHWQNGTK
AIFDSLKDSAYKTSRIVTF
Download sequence
Identical sequences ENSDORP00000014434 ENSDORP00000014434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]