SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDORP00000014464 from Dipodomys ordii 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDORP00000014464
Domain Number 1 Region: 216-260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000893
Family EGF-type module 0.056
Further Details:      
 
Weak hits

Sequence:  ENSDORP00000014464
Domain Number - Region: 11-95
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0264
Family APC10-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDORP00000014464   Gene: ENSDORG00000015371   Transcript: ENSDORT00000015370
Sequence length 273
Comment pep:known_by_projection scaffold:dipOrd1:scaffold_4731:7003:24848:-1 gene:ENSDORG00000015371 transcript:ENSDORT00000015370 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ENPYLCSNECDASNPDLAHPPRLMLDKEEEGLATYWQSVTWSRYPSPLEANITLSWNKSV
ELTDDVVLTFEYGRPTVMVLEKSLDNGRTWQPYQFYAEDCMEAFGMSARRARDMSSSSAH
RVLCTEEYSRWAGSKKEKHVRFEVRDRFAIFAGPDLRNMDNLYTRMESAKGLKDFFTFTD
LRVRLLRPALGGTYVQRENLYKYFYAISNIEVIGRCKCNLHANLCSVREGSLQCECEHNT
TGPDCGKCKKNFRTRAWRAGSYLPLPHGSPNAC
Download sequence
Identical sequences ENSDORP00000014464 ENSDORP00000014464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]